KEGG   Nitrobacter winogradskyi: Nwi_2252Help
Entry
Nwi_2252          CDS       T00276                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00071  Fatty acid degradation
nwi00280  Valine, leucine and isoleucine degradation
nwi00281  Geraniol degradation
nwi00310  Lysine degradation
nwi00360  Phenylalanine metabolism
nwi00362  Benzoate degradation
nwi00380  Tryptophan metabolism
nwi00410  beta-Alanine metabolism
nwi00627  Aminobenzoate degradation
nwi00640  Propanoate metabolism
nwi00650  Butanoate metabolism
nwi00903  Limonene and pinene degradation
nwi00930  Caprolactam degradation
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
nwi01130  Biosynthesis of antibiotics
nwi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Nwi_2252
   00650 Butanoate metabolism
    Nwi_2252
  Lipid metabolism
   00071 Fatty acid degradation
    Nwi_2252
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nwi_2252
   00310 Lysine degradation
    Nwi_2252
   00360 Phenylalanine metabolism
    Nwi_2252
   00380 Tryptophan metabolism
    Nwi_2252
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Nwi_2252
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Nwi_2252
   00281 Geraniol degradation
    Nwi_2252
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nwi_2252
   00627 Aminobenzoate degradation
    Nwi_2252
   00930 Caprolactam degradation
    Nwi_2252
Enzymes [BR:nwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Nwi_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ABA05506
UniProt: Q3SQD5
Position
2448842..2449621
Genome map
AA seq 259 aa AA seqDB search
MRTFEHIIIESKDQVGVIRLNRPKMLNALSFAVLREIAAAVDGFEADDGIGCILITGNEK
AFAAGADIKEMQPKSFIDMLNEDFKAIGGDRIATCRKPTIAAVSGYALGGGCELAMMCDI
IIASDNATFGQPEITLGTIPGIGGTQRLTRAIGKAKAMDLCLTGRMMDAAEAERSGLVSR
VVPVDKLMDEAMAAAKKIASMSRPAAAMAKDAVNRAFETTLSEGMNVERDLFRATFALED
RAEGMAAFIEKRKPTNKNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactttcgagcacatcatcatcgagagcaaggaccaggtcggcgtcatccgattg
aaccgcccgaaaatgctcaacgcgctgtctttcgcggtgcttcgcgagatcgcagcggcg
gtcgacgggttcgaggccgacgacggaatcggatgcatcctgatcaccggcaacgagaag
gcattcgccgccggagccgacatcaaggagatgcagccgaaaagcttcatcgatatgctc
aacgaggacttcaaggccatcggcggcgaccgtatcgccacctgccgcaagccgacgatc
gcggcggtcagcggctacgcgctcggcggcggctgcgaactggccatgatgtgcgacatc
atcatcgcctccgacaacgcgacattcggccaacccgaaatcaccctcggcaccattccc
ggcatcggcggcacgcagcgcctgacccgcgccatcggcaaggccaaggcgatggacctc
tgcctcaccgggcggatgatggacgcagccgaggcggagcgttcgggcctcgtcagtcgc
gtcgtgcccgtcgacaagctgatggacgaggcgatggctgccgcgaaaaaaatcgcgtcg
atgtcgcgtccagccgcggcgatggcgaaggacgccgtgaaccgcgccttcgaaaccacg
ctgtcggaaggcatgaacgtcgagcgcgacctgtttcgtgcgaccttcgcgctggaggat
cgcgccgaaggcatggcggcgttcatcgagaagcgcaagccgaccaacaagaaccgatga

DBGET integrated database retrieval system