KEGG   Nitrobacter winogradskyi: Nwi_2277Help
Entry
Nwi_2277          CDS       T00276                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00970  Aminoacyl-tRNA biosynthesis
nwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Nwi_2277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nwi03029]
    Nwi_2277
Enzymes [BR:nwi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Nwi_2277
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Nwi_2277
Mitochondrial biogenesis [BR:nwi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Nwi_2277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABA05531
UniProt: Q3SQB0
Position
complement(2484111..2485460)
Genome map
AA seq 449 aa AA seqDB search
MPDDPTLATLAADLAAGRTTARALVSDCLAKIADQAGEGARVFIQVDADAAIAAAEAMDR
LRGVNAAPSPYAGIPVSIKDLFDVRGQVSRAGSLALKDAPPAAKDAPVVARLRRAGFVVI
GRTNMTEFAYSGLGINPHYGTPKNGWRRDVGHVPGGSSSGAAVSITDGMAHGALGTDTGG
SCRIPAAYCGIVGYKPTARRIPLDGGVPLSVTLDSYGPIARSVGCCAVLDAVLADEPVTA
VAPRPVRGLRFAAPTTVMLDRLDPAVASAFERALDLLADAGALIDHIAVPEFGEVAELNI
GGGFAAAESWAWHRALIAEKAELYDPRVLSRIRYGEGLSAADYVDLLSVRRAIIGSFGRR
VAPYDGLLSPTVAITPPRIADLADDAAYVKANMLSLRNCSLINILDGCAISLPCHRESEP
PVGLMLAGTGGADRRIFELAAAIEPIVRG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgatccgaccctggccacgctcgccgccgatctcgcggcgggccgtaccacg
gcgcgcgccctggtcagcgactgccttgcgaaaatcgcggaccaggcgggcgagggcgcg
cgcgtgttcatccaggtcgatgcggacgccgcgatcgccgcggccgaggccatggacagg
ctgcgcggggtcaacgccgcgccgtcgccgtacgcaggcattccggtttcgatcaaggat
ctgttcgacgtcaggggacaggtctcgcgtgccgggtcgctggcgcttaaggatgcgcct
ccggccgcgaaggacgccccggtcgtggcgcgcctgcgccgggccggcttcgtggtgatc
gggcgcaccaacatgaccgaattcgcctattcgggtctgggcatcaatccgcactacggc
acgccgaaaaatggctggcgacgcgacgtcggccatgtgccgggcggatcgtcgtcgggc
gcggcagtctcgatcacggatggcatggcgcacggcgcgctcggcaccgacaccggagga
tcgtgccggattccggcggcctattgcggcatcgtcggctacaagccgaccgcgcgccgc
attccgctcgatggcggcgtcccgctgtccgtcacgctggacagttacggtccgatcgcg
cgttcggtcggctgctgcgccgtgctggacgcggttctggcggacgaaccggttacggcg
gtcgcgccgcgcccggtgagaggactgcggtttgccgcgccgaccacggtgatgctggac
cgcctcgatcccgccgttgcgtcggccttcgagcgcgcgctggaccttttggccgatgcc
ggcgcgttgatcgatcacatcgccgttcccgagttcggcgaggttgcggaactgaacatc
gggggcggattcgccgcggccgaaagctgggcctggcatcgcgcgctgatcgctgagaag
gcggaattgtacgatccccgcgtcctcagccgcattcggtacggcgaaggcctcagcgcg
gcggattatgttgatctgctctctgttcgacgcgcgatcatcggaagtttcgggcgtcgc
gttgcgccatacgacggattgctgtcgccgaccgttgccatcacgccgccgcggatagct
gatctcgccgatgatgcggcctacgtgaaagccaacatgctttcgctgcgcaactgctcg
ctgatcaacatcctcgatggatgcgcgatctcgctgccctgtcatcgcgagagcgagccg
ccggttggcctgatgcttgccgggacgggtggagcggatcgccggattttcgagcttgcg
gcggcgattgagccgatcgttcgcggctga

DBGET integrated database retrieval system