KEGG   Nitrosococcus wardiae: E3U44_03310Help
Entry
E3U44_03310       CDS       T05933                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nwr  Nitrosococcus wardiae
Pathway
nwr00260  Glycine, serine and threonine metabolism
nwr01100  Metabolic pathways
nwr01110  Biosynthesis of secondary metabolites
nwr01120  Microbial metabolism in diverse environments
nwr01130  Biosynthesis of antibiotics
nwr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nwr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E3U44_03310
Enzymes [BR:nwr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     E3U44_03310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: QBQ53642
UniProt: A0A4P7BYS1
Position
676468..677502
Genome map
AA seq 344 aa AA seqDB search
MSPIRINLYSDTQTLPTPAMRKAMAEAPVGDEQRGEDPSVNRLCEVVAELTGKEAAVFLP
SGTMCNEIAICVHCRPGDEIITDRTAHILNLEGGAPAALSGASIWPLEGIHGVFTAAQLQ
QGIRPQSRHTPRSRLVCVEQTANLGGGTVWPLETIQAVAEMARTHQLALHMDGARLFNAV
IATGIDAREHTASFDSVWFDLSKGLGCPVGGVLAGSAAFIEEAWWWKQRLGGAMRQAGIL
AAAGLYALEHHIERLAEDHRNARRFAEHIAEIPGISVALATVETNIVFFDVTATGLSAAE
VSDKLKSYGVLIGATDKTRLRAVTHLDISQTDIETAAKALREIC
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgatccgaattaacttatatagtgatacccagaccttacccacaccggcaatg
cgaaaagccatggccgaagcacctgtgggagatgaacagcgaggcgaagaccccagcgta
aaccgcctctgtgaggtggtggctgaactaaccggcaaggaggctgccgtatttttgcct
tcaggaaccatgtgcaatgaaattgccatctgcgtccattgccggcccggcgatgaaatc
attaccgaccgcacagctcatatccttaacttggaaggcggcgctcccgcagctctcagc
ggcgcctccatctggcccctggaaggaatccatggtgtattcactgccgctcaactccag
caagggatccgtccacagagccggcatacacctcgctcacggctagtttgcgtagaacaa
actgccaatctaggtggcggtaccgtctggcccctggagacgatccaagcagtggcggag
atggcccgaacccaccagttggcactgcacatggatggggcccgacttttcaatgcggtc
atagcaaccggtatcgacgcaagagaacatacggcatcctttgatagcgtgtggtttgac
ttaagcaagggccttggctgtcccgtaggaggagtgcttgcaggaagtgccgccttcatt
gaggaagcctggtggtggaagcagcgcctcggaggggccatgcgtcaggccggtatcctc
gctgctgctggcctctatgccctagagcatcacattgagcgtctcgctgaagaccatcgg
aatgcacgccgattcgccgaacatattgccgaaattcctggtatctctgttgccctagca
acggtggagacgaatatcgtcttttttgatgtcacagcaaccgggttgtcagcagcggag
gtcagtgacaagctcaaatcctatggcgtgctgattggtgccacggataaaactaggctc
cgcgccgtaacccatcttgatatctctcagacggatattgaaaccgcggcaaaggccctt
cgagaaatatgttaa

DBGET integrated database retrieval system