KEGG   Ornithorhynchus anatinus (platypus): 100073402
Entry
100073402         CDS       T01045                                 

Symbol
APAF1
Name
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01524  Platinum drug resistance
oaa04115  p53 signaling pathway
oaa04210  Apoptosis
oaa04215  Apoptosis - multiple species
oaa05010  Alzheimer disease
oaa05012  Parkinson disease
oaa05014  Amyotrophic lateral sclerosis
oaa05016  Huntington disease
oaa05020  Prion disease
oaa05022  Pathways of neurodegeneration - multiple diseases
oaa05134  Legionellosis
oaa05152  Tuberculosis
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05162  Measles
oaa05164  Influenza A
oaa05168  Herpes simplex virus 1 infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05222  Small cell lung cancer
oaa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100073402 (APAF1)
   04215 Apoptosis - multiple species
    100073402 (APAF1)
   04115 p53 signaling pathway
    100073402 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100073402 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100073402 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100073402 (APAF1)
   05160 Hepatitis C
    100073402 (APAF1)
   05164 Influenza A
    100073402 (APAF1)
   05162 Measles
    100073402 (APAF1)
   05168 Herpes simplex virus 1 infection
    100073402 (APAF1)
   05169 Epstein-Barr virus infection
    100073402 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100073402 (APAF1)
   05152 Tuberculosis
    100073402 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100073402 (APAF1)
   05012 Parkinson disease
    100073402 (APAF1)
   05014 Amyotrophic lateral sclerosis
    100073402 (APAF1)
   05016 Huntington disease
    100073402 (APAF1)
   05020 Prion disease
    100073402 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100073402 (APAF1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100073402 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100073402 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 NBCH_WD40 CARD WD40_like Ge1_WD40 eIF2A Nup160 CARD_2 AAA_16 DOG1 Hira
Other DBs
NCBI-GeneID: 100073402
NCBI-ProteinID: XP_028934743
Ensembl: ENSOANG00000005592
Position
14:36788879..36839428
AA seq 1250 aa
MDARARNCLLKHMEALEKDIKTSYIMDHMISDRTLTLSEEEKVRNQGTQEERAAMLIKLI
LEKDNFSYISFYNALLHEGYRDLAALLQDGIPFTASPKGNDSLDGVTSYVRTVLCEGGVP
QRPVVFVTRKKLVNEIQQKLYRLNDEPGWVTVYGMAGCGKSVLAAEALRDHRLLVDCFPG
GVHWISIGKQDKAGLLMKLQNLCMRFDQGSNFSQRPPLNIEEAKDRLRVLMLRKYPRSLL
ILDDVWDSWVLKAFDIQCQVLLTSRDKSVTDSVMGQKYVVPVESGLGKEKGLEILSLFVN
MKKTDLPEQAHSIVQECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLTEEFKDYYKDLSVLQKDVKVPTKVICILWEMETEEVEDILQEFVN
KSLLFCDRNGKTFHYYLHDLQVDFLTEKNRSQLQELHKKIVNQYQKYYQLRTLSPDQDDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKSKTELVGPAHLIHEFAEYSHILDEKDCTV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYRQAKLRAKQEVDKGMLYLEWINK
KNIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTVQVFKAETGEKLLEIKAHEDEV
LCCAFSPDDKFVATCSTDKKVKVWNSQTGKLVHTYEEHTEQVNFCQFSNTSSHPLLATCS
NDQFLKLWDLNQKGCRNTMFGHSDSVNHCKFSPDDKYLASCSADGTLKLWKVASANEWKS
IDVSKFFQTSEHEEDVEVLVKCCSWTTDGATIMVTAKNMIFLFDVKTSGLSAEIQTSHHS
TIQYCDFYPCSHLAVVALSHYCVELWNTDSCLKVADCRGHLSWVHCVTFSPDGSSFLTSS
DDQTIRVWDTSKVCKNSAVMLKQEIDVVFRDNEVMVLAVDSLRHLQLINGKTGQTDYLTE
AQESLICCCCLSPTLISLAFGEEDGTVKILELPNGRMFKSKIKHKKPVQHCRFTSDGKTV
ISSSDDPVIQVWIWQTEEYVFLQAHQESVKDFRLLQNSRLFSWSFDGTIKVWNILTGKVE
KDFFCHQGAVLSCNISPDATKFSSTSADKTAKIWSFENSSLLHELSGHEGCVRCSAFSDD
SSLLATGDDNGEIRIWDVSKGEILHLCAPGPVGEASTHGGWVTDLCFSPDSKILVSAGGF
LKWWNMDTGESLQTFYTNGTNLKTIFVSPSFKSYVTVDNLGILYVLQMLE
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggatgccagagctcgaaattgcttgcttaagcatatggaggcattggaaaaagatatc
aagacctcctatattatggaccacatgatttcagatagaacattaaccttatcagaagag
gagaaagtaagaaatcagggcacccaagaggaaagagctgcaatgttaattaaattgatt
cttgaaaaagacaatttttcatacatatcattctacaatgctctgttacatgaggggtac
agagatctcgccgcccttctccaagatgggattccgttcactgcttctcccaagggaaat
gattcattggatggcgtgacttcttatgtcaggacagtcttgtgtgaaggtggagtacct
cagcggccagttgtgtttgttactcggaaaaaactggtgaatgaaattcaacagaagttg
tacagactgaatgatgaaccaggctgggtcacggtgtatggtatggcaggctgcggaaag
tcagttttagcagctgaagctctcagagaccaccgtctcttagtagattgctttccagga
ggcgtgcattggatttcgattggaaaacaagataaagcagggctcctcatgaaacttcag
aatctttgcatgcggttcgatcaaggctctaacttctcccagaggccaccgttaaacatc
gaagaggctaaagatcggcttcgtgttctgatgctgcgtaaatacccaaggtctctcttg
atcctggatgatgtctgggattcctgggtgttaaaagcttttgatattcagtgtcaagtt
cttctcacaagcagagacaagagtgtgactgactctgttatgggtcaaaaatatgttgtc
cctgtggagagtgggttgggcaaggagaaaggacttgagattttgtccctttttgttaat
atgaaaaagacagaccttccagaacaagctcatagtattgtccaggagtgtaaaggttca
cctcttgtagtatctttaattggagcattattgcgtgattttcccaatcgctgggagtac
tacctcagacagcttcagaataagcagtttaaaagaataaggaaatcgtcatcttatgat
tatgaagccttggatgaagccatgtcaataagtgttgaaatgctcacagaagaattcaaa
gactattacaaagatctttctgtccttcaaaaggatgttaaagtacccaccaaggtgata
tgcattctctgggaaatggagactgaagaagttgaagacatactacaagaatttgtcaat
aaatctctcctgttttgtgatcgcaatggaaagacatttcattattatttacatgatctt
caagttgactttcttacagagaaaaatcgcagtcaacttcaggagctgcataaaaagata
gtcaatcaatatcagaaatattaccagttacgcaccctatctccagatcaggacgactgt
atgtattggtacaactttctggcctatcacatggcaagtgccaatatgcataaagaactt
tgtgctctcatgttttccctggattggattaaatcaaaaacggagctggtaggacctgct
catctgattcatgagtttgcagaatatagccatatattggatgagaaggattgcaccgtc
tgtgagaattttcaggagtttttgtctttaaatggacatcttctaggaaggcagccattt
cctaacattgtacaactaggactctgtgaacctgaaacttctgaagtgtatcgacaagcc
aaattacgggccaagcaagaggttgataaaggaatgctttacctggaatggataaacaaa
aaaaacatcaagaacctctcccgcttggttgtccgcccacatacagatgctgtttaccat
gcctgcttctctgaggatggccagagaatagcttcttgtggagctgataaaaccgtacag
gtatttaaagctgaaactggtgagaaacttctggaaatcaaggcccatgaagatgaagtg
ctttgttgtgcattctctccggatgacaaatttgtagcaacctgttcgaccgataaaaaa
gtgaaggtttggaattcgcagacagggaaactagttcatacttatgaggagcatacagag
caggtcaacttctgccaattctccaacacatccagtcaccctttgttagccacctgttcc
aatgaccagttcctcaaactctgggacttgaaccaaaaaggatgtcggaatacaatgttt
ggtcattcagattcagtcaaccactgcaagttttccccagatgataagtatttggctagt
tgttcagcagatgggacattaaagctttggaaagtggcttcagcaaatgagtggaaaagc
atcgatgtgagtaagttttttcaaacttcagaacatgaggaagatgtggaagttttggtg
aagtgttgttcgtggacaactgatggtgccacaataatggtgacagccaaaaacatgatt
tttcttttcgatgtgaaaactagtggcctgtcagcagaaatccaaacaagccatcacagc
accatacaatactgtgacttctatccgtgcagccacttggcagtagttgccctgtcacat
tactgtgtggagttatggaatacagattcttgtcttaaagtagctgactgtagaggacac
ctaagctgggtccattgtgtgacattttctcctgatggatcttcgtttttgacatcttct
gatgaccagacaattagggtttgggatacaagtaaagtgtgcaagaattcagctgtaatg
ttaaagcaagaaatagatgttgtattccgggacaatgaagtgatggttcttgctgttgac
agcctaagacatctgcaactaataaatggaaaaactggtcaaacggattatttgactgaa
gctcaggaatctctcatttgttgctgttgtctaagtccgactctcatatctctagctttt
ggagaagaagatggaactgtcaagattttggagctcccaaatggaagaatgttcaaatcc
aagattaagcataagaaacctgtacaacactgccgatttacatcagatggcaagactgtt
atttcaagctctgatgaccctgtcattcaggtgtggatttggcagacggaagaatatgtg
tttcttcaagcacaccaagaatcagtgaaggattttaggcttttgcagaattcaagatta
ttttcctggtcctttgatggaacaattaaggtttggaacattttgacggggaaagtagaa
aaagactttttctgtcatcaaggtgcagttctgtcttgtaatatttcaccggatgccaca
aagttttcatctacctctgccgacaaaactgccaagatttggagttttgagaactcgtca
cttcttcatgaactgagcggccatgaaggctgtgtgagatgttctgccttttctgatgac
agttcattactggcaactggagatgacaacggagaaataaggatatgggatgtctcaaaa
ggcgagatcctccacttgtgtgctcccggcccagtgggtgaagcatccactcatggtggt
tgggtgaccgacctctgcttttcccccgatagcaaaatcctggtgtcggctggtggattc
cttaagtggtggaatatggacacaggagaatccttacagaccttttacacaaatggaacc
aatctcaagacaatatttgtgtctcctagtttcaaatcttatgttaccgttgataatctt
ggcattttatatgttctacagatgttggagtga

DBGET integrated database retrieval system