KEGG   Ornithorhynchus anatinus (platypus): 100073788Help
Entry
100073788         CDS       T01045                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00562  Inositol phosphate metabolism
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa01522  Endocrine resistance
oaa01524  Platinum drug resistance
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04070  Phosphatidylinositol signaling system
oaa04071  Sphingolipid signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04140  Autophagy - animal
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04152  AMPK signaling pathway
oaa04210  Apoptosis
oaa04211  Longevity regulating pathway
oaa04213  Longevity regulating pathway - multiple species
oaa04218  Cellular senescence
oaa04360  Axon guidance
oaa04370  VEGF signaling pathway
oaa04380  Osteoclast differentiation
oaa04510  Focal adhesion
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04611  Platelet activation
oaa04620  Toll-like receptor signaling pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04630  Jak-STAT signaling pathway
oaa04650  Natural killer cell mediated cytotoxicity
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04666  Fc gamma R-mediated phagocytosis
oaa04668  TNF signaling pathway
oaa04670  Leukocyte transendothelial migration
oaa04722  Neurotrophin signaling pathway
oaa04725  Cholinergic synapse
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04810  Regulation of actin cytoskeleton
oaa04910  Insulin signaling pathway
oaa04914  Progesterone-mediated oocyte maturation
oaa04915  Estrogen signaling pathway
oaa04917  Prolactin signaling pathway
oaa04919  Thyroid hormone signaling pathway
oaa04923  Regulation of lipolysis in adipocytes
oaa04926  Relaxin signaling pathway
oaa04930  Type II diabetes mellitus
oaa04931  Insulin resistance
oaa04932  Non-alcoholic fatty liver disease (NAFLD)
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa04960  Aldosterone-regulated sodium reabsorption
oaa04973  Carbohydrate digestion and absorption
oaa05100  Bacterial invasion of epithelial cells
oaa05142  Chagas disease (American trypanosomiasis)
oaa05146  Amoebiasis
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05162  Measles
oaa05164  Influenza A
oaa05165  Human papillomavirus infection
oaa05166  HTLV-I infection
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05212  Pancreatic cancer
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05218  Melanoma
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05222  Small cell lung cancer
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05230  Central carbon metabolism in cancer
oaa05231  Choline metabolism in cancer
oaa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100073788 (PIK3CA)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100073788 (PIK3CA)
   04015 Rap1 signaling pathway
    100073788 (PIK3CA)
   04012 ErbB signaling pathway
    100073788 (PIK3CA)
   04370 VEGF signaling pathway
    100073788 (PIK3CA)
   04630 Jak-STAT signaling pathway
    100073788 (PIK3CA)
   04668 TNF signaling pathway
    100073788 (PIK3CA)
   04066 HIF-1 signaling pathway
    100073788 (PIK3CA)
   04068 FoxO signaling pathway
    100073788 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100073788 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100073788 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100073788 (PIK3CA)
   04024 cAMP signaling pathway
    100073788 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100073788 (PIK3CA)
   04152 AMPK signaling pathway
    100073788 (PIK3CA)
   04150 mTOR signaling pathway
    100073788 (PIK3CA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100073788 (PIK3CA)
  Cell growth and death
   04210 Apoptosis
    100073788 (PIK3CA)
   04218 Cellular senescence
    100073788 (PIK3CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100073788 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100073788 (PIK3CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100073788 (PIK3CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100073788 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100073788 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100073788 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100073788 (PIK3CA)
   04660 T cell receptor signaling pathway
    100073788 (PIK3CA)
   04662 B cell receptor signaling pathway
    100073788 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100073788 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100073788 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100073788 (PIK3CA)
   04062 Chemokine signaling pathway
    100073788 (PIK3CA)
  Endocrine system
   04910 Insulin signaling pathway
    100073788 (PIK3CA)
   04923 Regulation of lipolysis in adipocyte
    100073788 (PIK3CA)
   04915 Estrogen signaling pathway
    100073788 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100073788 (PIK3CA)
   04917 Prolactin signaling pathway
    100073788 (PIK3CA)
   04926 Relaxin signaling pathway
    100073788 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100073788 (PIK3CA)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100073788 (PIK3CA)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100073788 (PIK3CA)
  Nervous system
   04725 Cholinergic synapse
    100073788 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100073788 (PIK3CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100073788 (PIK3CA)
  Development
   04360 Axon guidance
    100073788 (PIK3CA)
   04380 Osteoclast differentiation
    100073788 (PIK3CA)
  Aging
   04211 Longevity regulating pathway - mammal
    100073788 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100073788 (PIK3CA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100073788 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100073788 (PIK3CA)
   05231 Choline metabolism in cancer
    100073788 (PIK3CA)
   05205 Proteoglycans in cancer
    100073788 (PIK3CA)
   05203 Viral carcinogenesis
    100073788 (PIK3CA)
   05210 Colorectal cancer
    100073788 (PIK3CA)
   05212 Pancreatic cancer
    100073788 (PIK3CA)
   05225 Hepatocellular carcinoma
    100073788 (PIK3CA)
   05226 Gastric cancer
    100073788 (PIK3CA)
   05214 Glioma
    100073788 (PIK3CA)
   05221 Acute myeloid leukemia
    100073788 (PIK3CA)
   05220 Chronic myeloid leukemia
    100073788 (PIK3CA)
   05218 Melanoma
    100073788 (PIK3CA)
   05211 Renal cell carcinoma
    100073788 (PIK3CA)
   05215 Prostate cancer
    100073788 (PIK3CA)
   05213 Endometrial cancer
    100073788 (PIK3CA)
   05224 Breast cancer
    100073788 (PIK3CA)
   05222 Small cell lung cancer
    100073788 (PIK3CA)
   05223 Non-small cell lung cancer
    100073788 (PIK3CA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100073788 (PIK3CA)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100073788 (PIK3CA)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100073788 (PIK3CA)
   04931 Insulin resistance
    100073788 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100073788 (PIK3CA)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100073788 (PIK3CA)
   05166 HTLV-I infection
    100073788 (PIK3CA)
   05162 Measles
    100073788 (PIK3CA)
   05164 Influenza A
    100073788 (PIK3CA)
   05161 Hepatitis B
    100073788 (PIK3CA)
   05160 Hepatitis C
    100073788 (PIK3CA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100073788 (PIK3CA)
   05169 Epstein-Barr virus infection
    100073788 (PIK3CA)
   05165 Human papillomavirus infection
    100073788 (PIK3CA)
   05146 Amoebiasis
    100073788 (PIK3CA)
   05142 Chagas disease (American trypanosomiasis)
    100073788 (PIK3CA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100073788 (PIK3CA)
   01524 Platinum drug resistance
    100073788 (PIK3CA)
   01522 Endocrine resistance
    100073788 (PIK3CA)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100073788 (PIK3CA)
Membrane trafficking [BR:oaa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100073788 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF4135 Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 100073788
NCBI-ProteinID: XP_001505664
Position
Un
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRIIVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDVNAPHSRALYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEASAKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLMYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSPVKFPDMTVIEEHANWTVSRELGFNYSHAGLSNRIARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTTPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPRVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactatggggcatccacttgatgcccccaagaatc
atagtagaatgtctactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattagtaactattaaacatgaactctttaaagaagcaagaaagtacccccttcatcaa
ctccttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagagaa
gaattttttgatgaaacgcgacgcctttgtgacctacggctttttcaacctttcctcaaa
gtcattgaaccagtgggcaaccgagaagaaaagatcctcaatcgagaaattggtttcgca
attggaatgcccgtctgtgaatttgacatggtcaaggatccagaagtacaggactttcga
agaaatattcttaatgtttgtaaagaagctgtggatcttcgagatgttaacgcaccccat
agtagagcattgtatgtctatcctccaaatgtagagtcgtcacctgaactgccaaagcac
atatataataaactagataaaggacaaataatagtggtgatttgggtgatagtgtctcca
aataatgacaagcagaaatacaccttaaaaatcaaccacgattgtgtgcccgaacaagtg
atagctgaagcgattaggaaaaaaacacgaagtatgctgctgtcatctgaacaactgaaa
ctctgtgtcttggaatatcagggcaaatatattttaaaagtatgtggatgtgacgaatac
ttactcgaaaagtatcccctgagtcaatataagtatataagaagctgtataatgcttggt
cggatgcccaatttgatgttaatggctaaagaaagcctttatacccagctgccattggat
acttttacaatgccatcttattccagacgcatctccacagcaacaccatatatgaatgga
gaagcttcagcaaaatctctttgggtcattaacagtgcattacgaataaagattctgtgt
gcaacctatgtaaatgtaaatattcgagacattgacaagatttacgttcgaacgggtatc
taccatggaggagaaccattatgtgacaatgtaaatactcagagggtcccttgttccaat
cccagatggaatgaatggctgatgtatgacatgtacattcctgatcttccacgtgctgct
cggctttgcctttccatttgttccgttaaaggcagaaagggtgcaaaagaggaacactgc
cctttggcttggggaaatatcaatttatttgattataccgacactctcgtatctgggaaa
atggctctgaatctgtggccagtgcctcatggattggaagacttgctcaaccctattggt
gtgactggctcaaatccaaataaggaaactccatgcttagagctggaatttgactggttc
agcagccctgtgaagtttccagatatgacagtaattgaagagcatgctaattggactgta
tcccgagaactgggatttaattactcccatgctggactgagtaacaggatagctagagac
aatgagttacgggaaaatgacaaagagcagctccgggcaatttgtacaagagacccactt
tctgaaatcactgagcaagaaaaggacttcctttggagtcacagacattattgtgtgact
accccagaaatcctaccaaaactgcttttgtctgttaaatggaactctagagacgaagta
gcccagatgtactgcttggtaaaagattggccaccaatcaaacccgaacaggcaatggag
cttttggactgtaactatcctgacccgagggtccgagcctttgcagttcgttgcctagaa
aagtatctgactgatgacaaactctctcagtacctcattcaattagtccaggttttgaaa
tatgagcaatatttggataacttgcttgtgagatttttacttaagaaggcactgaccaat
caaaggataggacattttttcttttggcacttaaagtctgaaatgcataataaaacggtc
agccagagatttggtttgcttttggagtcctattgccgtgcatgtggaatgtatctaaaa
cacctgaacaggcaggtggaggctatggagaaattgattaaccttacggatattctcaaa
caggagaagaaggatgaaactcaaaaggtgcagatgaagttcctagtcgaacagatgaga
cggcccgatttcatggatgctttacagggctttatctctcctcttaaccctgcccatcag
ttgggaaatctcaggctcgaggaatgtcggattatgtcgtctgcaaaacggccactgtgg
ttaaattgggagaacccagacatcatgtcagagttgttgtttcagaataacgagatcatc
tttaaaaatggggatgatttacgtcaggatatgttaacacttcagattattcgaattatg
gaaaacatctggcaaaaccagggtcttgacctccggatgttaccttatggatgtctttcg
attggagactgtgtggggcttatcgaggtggtgagaaattcccatacaattatgcaaatt
cagtgtaaaggaggccttaaaggtgcattgcagttcaatagccatacgttgcatcagtgg
ctcaaagacaagaacaaaggagaaatgtatgatgctgccattgatttatttacacgctcc
tgtgctggttattgtgttgctaccttcatcctgggaattggggatcgccacaatagtaac
atcatggtaaaagatgatggacaactgtttcatatagattttggacacttcttggatcac
aaaaagaaaaagtttggttacaaacgggagcgagtgccatttgtcttgacacaagacttc
ttaatagtgattagtaaaggtgcccaagaatgcactaaaacaagagaatttgagaggttt
caggagatgtgttacaaggcttacctagctattcgtcaacatgccaatctcttcataaat
ctgttctctatgatgctcggctctggaatgccagaactacagtccttcgatgacattgcc
tatattcggaaaaccttggccttggataaaacagagcaggaggctctggagtatttcatg
aagcaaatgaatgatgcacaccatggaggctggacaacaaaaatggactggatcttccac
acaattaagcaacatgctttgaactga

DBGET integrated database retrieval system