KEGG   Ornithorhynchus anatinus (platypus): 100074630
Entry
100074630         CDS       T01045                                 
Symbol
AMPD1
Name
(RefSeq) AMP deaminase 1 isoform X1
  KO
K01490  AMP deaminase [EC:3.5.4.6]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00230  Purine metabolism
oaa01100  Metabolic pathways
oaa01232  Nucleotide metabolism
Module
oaa_M00958  Adenine ribonucleotide degradation, AMP => Urate
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100074630 (AMPD1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     100074630 (AMPD1)
SSDB
Motif
Pfam: AMP_deaminase A_deaminase
Other DBs
NCBI-GeneID: 100074630
NCBI-ProteinID: XP_028924323
Ensembl: ENSOANG00000004517
Position
7:55349690..55375687
AA seq 773 aa
MSDSFIVSGSHPYFPSPLSSPVPLSRFPATMPLVKVPDMDDAMRSLAERVFASEVKDEGG
RHELSPFDVDELCPISHHERQAHIFHQEKKTAEGRRKKRFQSRKTVVLSHPSMEESSTKL
PASDDHVSSSPLYQTVPDFQRVQITGDYASGVTVEDFEVVCAGFYRALCIREKYMNKSFQ
RFPRTSSKYLRKMEGDVWKVDESLYPVFTPPVTKGEDPFQKDDLPENLGYYLKMKDGVVY
IYTDEAAAKRDEPQHLPYPNLNIFLEDMNYLLALIAQGPVKTYAHRRLKFLSSKFQVHEM
LNEMEEMKELKNNPHRDFYNCRKVDTHIHAAACMNQKHLLHFIKKSYRMDADRVVYTSKE
KKLTLKELFANLKMHPYDLTVDSLDVHAGRQTFQRFDKFNDKYNPVGASELRDLYLKTDN
SINGEYFATIIKEVAADLEDAKYQHAEPRLSIYGRSPEEWSKLASWFVQNRVYSSNMMWM
IQVPRIYDVFRAKNFLPHFGKMLENIFLPVFEATINPQANPDLSIFLKHITGFDSVDDES
KHSGHMFSSKSPKPEEWMMEKNPSYTYYAYYMYANLVVLNSLRKKRGMNTFLFRPHCGEA
GAITHLMTAFMTADNISHGLNLKKSPVLEYLYFLAQIPIAMSPLSNNSLFLEYAKNPLLD
FLQKGLMISLSTDDPMQFHFTKEPLMEEYAIAAQVFKLSTCDMCEVARNSVLQCGMSHQE
KARFLGDNYLEEGPRGNDIRKTNVAQIRMMYRYETWCYELALIAEGLNCHVEP
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgtcagacagttttatcgtatcgggcagtcacccctactttccgtcccctctctccagt
cctgtccctctatcgaggttcccagcaaccatgccgcttgttaaagttccagatatggac
gatgcaatgcgtagcttggctgaaagagtttttgcctctgaagtgaaggatgagggaggt
cgacatgagctgtccccatttgatgtggatgaactatgccccatttctcaccacgagagg
caagctcacatattccaccaggagaagaaaactgctgaaggaagacggaagaaacgtttt
cagagtcggaagacagttgtcctgtctcatccatcaatggaggaatcttcaacaaagctg
cctgcctccgatgaccatgtttcctcatccccattataccagaccgtgcctgacttccag
agggttcagattaccggtgactacgcctctggggtcacagttgaagattttgaagttgtg
tgcgcgggtttctatcgtgcattatgtattcgggagaagtatatgaacaagtcatttcag
aggttccctagaacctcttccaagtaccttcgtaaaatggaaggagatgtttggaaagta
gacgagagcttatatccagtctttacccctcccgtgacgaagggagaagatcctttccaa
aaagacgatctccctgaaaaccttgggtattatttaaaaatgaaggatggtgtggtttac
atatacactgatgaagcagctgccaaaagagatgaacctcaacatctgccttacccaaat
ctgaacatcttcctagaagatatgaattatctactggcattaattgctcaaggtcctgtt
aaaacctatgcccaccgacgcctgaagtttttgtcctccaagttccaggttcatgagatg
ttaaatgagatggaagaaatgaaagaactgaagaacaaccctcaccgagatttctacaac
tgtaggaaggtggacacgcatatccatgctgctgcctgtatgaatcagaagcacctgcta
cacttcattaagaaatcctaccggatggatgccgatagagtggtctacacctccaaagag
aaaaagctgaccttaaaggaactctttgccaatttgaaaatgcacccctatgacctaact
gttgattctctggatgttcatgcaggacgtcagaccttccagcgtttcgacaagttcaat
gataagtacaaccctgtgggagccagtgagctgcgggacctctacctgaagacggacaac
tccattaacggggagtattttgccactattatcaaggaggtggccgcggacctggaagac
gccaagtaccagcacgcagaaccccggctgtccatctatggccgcagccccgaggagtgg
tccaaactggcttcctggtttgtccagaaccgagtctacagctccaacatgatgtggatg
atccaggtccctaggatctatgatgtgttccgggccaagaatttcctcccacatttcggc
aagatgctggaaaatatattcctgccagtgtttgaagccacaatcaatccccaggccaat
ccagacttgagtatcttcctcaagcatatcaccggctttgacagcgtggatgatgaatcc
aaacacagcggccacatgttttcatccaagagtcccaaacctgaggagtggatgatggag
aagaatccatcatatacgtactacgcatactacatgtacgccaacctcgtggtgctcaac
agtctgaggaagaagagaggaatgaacacctttctctttcgccctcactgtggggaagct
ggagctattacacatctaatgacagcattcatgacggcagacaatatctcccacggctta
aatttaaaaaagagtcctgtgctggaatacttatattttctggctcagattcccattgcc
atgtcacctctaagtaacaacagcctcttcctagaatatgctaaaaatccactgttggat
tttcttcagaaaggcctgatgatttcactctccacagatgatccaatgcaattccatttc
accaaggagccactgatggaggaatatgccattgctgcccaggtcttcaaactcagcacc
tgtgatatgtgtgaagtggcaagaaacagtgtcctgcaatgcggcatgtcccatcaggag
aaagcaaggtttctgggagacaattaccttgaggaaggccctcgtgggaatgacatccgg
aaaacaaatgtagcccaaatccgcatgatgtatcgctatgaaacctggtgttatgaactc
gccttaattgctgagggccttaattgccatgtggaaccctga

DBGET integrated database retrieval system