KEGG   Ornithorhynchus anatinus (platypus): 100074676Help
Entry
100074676         CDS       T01045                                 

Gene name
NLN
Definition
(RefSeq) neurolysin, mitochondrial isoform X1
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    100074676 (NLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oaa01002]
    100074676 (NLN)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     100074676 (NLN)
Peptidases and inhibitors [BR:oaa01002]
 Metallo peptidases
  Family M3
   100074676 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 100074676
NCBI-ProteinID: XP_028922744
Position
1
AA seq 724 aa AA seqDB search
MLALAAWALRGLPRAGGSAFLPRMTLGRGGAASLRVISSRSATSGNFLKWDLTPEQIKAR
TEDLIVQTKQVYDAVGMLDVEKVTYENSLQVLADLEVKYAVERSILDFPQHVSPDKDVRA
ASTEADKRLSRFDVEMSMREDVFQRIVHLQRTCDLGKVKPEAKRYLEKSIQMGKRNGLHL
SPEVQSEIKSMKKRMSELCIDFNKNLNEDNSFLTFSKDELGSLPDDFIDSLEKVENNKYK
VTLKYPHYFPVMKKCCISETRRKMELAFNTRCKEENTKILQELLPLRAKVAELLGYNTHA
DFVLEVNTAKSTSCVAVFLDDLSKKLKPLGEEERQLILDLKKKECAERGFDYDGKINAWD
LYYYMTRVEELKFSIDQEKLKEYFPIEAVTEGLLTIYQELLGLSFEQVADASVWNESVTL
YAVKDKATGETLGQFYLDLYPRDGKYGHAACFGLQPGCLLPDGSRMTSVAVLVVNFSRPA
AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDPD
SLRQLSRHYKDGSPIPDNLLDNLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDSANEY
AKLCLEILGISATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDIFCSSFQREGLMNPE
SISTTEQPLDGVRALWRNQGRGRGQESWVPPYSAECGGYEIPKPHPETWGILGRHGHASE
FLEP
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccctcgccgcttgggcgctcagaggcctccccagagccggcggttccgcgttc
ctaccaagaatgacgctggggagaggcggcgcggccagcctccgggtcatttcttcccgt
tcggcgaccagcggaaacttcttaaaatgggacctcaccccggagcagatcaaggcaagg
accgaagacctgatcgtgcagaccaagcaggtgtacgacgccgttggaatgctggatgtc
gaaaaggtcacgtacgaaaacagtttgcaggtcttggcggatctggaggtgaagtatgca
gtggaaaggagcatcttggactttccccagcacgtctcccctgacaaggatgtgcgagcg
gcaagcacggaggcagataagagactttcccgtttcgacgtcgagatgagcatgagagaa
gacgtctttcagaggattgttcatctccagcggacgtgtgacctcgggaaggtgaagccc
gaagccaagcggtacttggagaagtccattcagatggggaagaggaacggcctccatctg
tcgccggaagtgcagagcgaaattaaatcgatgaagaagcggatgagtgaactgtgtata
gacttcaacaagaaccttaatgaagataacagcttcctgacattctccaaggatgaactt
ggctcccttcccgatgatttcattgacagcttagaaaaggtggaaaataacaaatataaa
gttaccttgaaatatccccactactttccggtcatgaaaaagtgctgcatctcggagacc
agaaggaagatggagcttgcttttaacacaaggtgcaaagaggagaacaccaagatcctt
caggagttgcttcctctccgtgccaaagtagcagagctgcttggctataacacccacgcc
gacttcgttctcgaggtgaacactgcgaagagcaccagttgcgtagctgtcttcctcgac
gacttaagcaagaagctgaaacctctaggggaggaggagcgccagctgatcctggacctg
aagaaaaaagagtgcgcggagcgggggtttgactacgacgggaaaatcaacgcttgggat
ctgtattactacatgacccgggtagaggagctcaaattctccatcgaccaggagaagctc
aaggagtacttccccatcgaagcggtcacggaaggcctgctgaccatctaccaggagttg
ctgggactgtcgttcgagcaagtggccgacgccagcgtttggaatgagagcgtcaccctc
tacgccgtgaaggataaggctaccggggagaccttgggacagttctacctggacctctac
ccaagggacgggaagtacggccacgcggcctgcttcggcctccagcccggctgcctcctc
cccgacggcagccgcatgacgtccgtggccgtcctggtggtgaacttctcccggccggcc
gccggccggccctccctgctgcggcacgacgaggtgaggacctacttccacgagttcggc
cacgtcatgcatcagatatgtgcacagaccgattttgctcgattcagcggcacgaacgtg
gaaaccgacttcgtcgaggtgccttcccagatgctggagaattgggtgtgggaccccgac
tccctccggcagctctccagacattataaggacggcagccccatcccagacaacctcctg
gacaacctcgtggcttcccggctggtcaacacaggcctgttgaccctgcggcagattgtt
ctgagcaaagtggatcagtctcttcatacgaacacgtcgctggactccgcaaacgagtac
gccaagctctgcctggagatcctagggatttcagcaactccaggaacaaatatgccggct
acctttggacacctggcaggcggctacgatggccagtattacggatacctctggagcgaa
gtgttttccatggacatcttctgtagcagcttccagcgagaaggattgatgaatcccgag
agcatatcaaccacagagcagcccctcgacggggtcagggcgttgtggaggaatcagggc
agagggaggggacaggagtcctgggtcccaccatactcagccgagtgcggtgggtatgaa
ataccgaaacctcatcctgaaacctgggggatccttggacggcatggacatgcttcagaa
tttcttgaaccgtga

DBGET integrated database retrieval system