KEGG   Ornithorhynchus anatinus (platypus): 100075024Help
Entry
100075024         CDS       T01045                                 

Gene name
CHRNA4
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4 isoform X1
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04080  Neuroactive ligand-receptor interaction
oaa04725  Cholinergic synapse
oaa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100075024 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100075024 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100075024 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oaa04040]
    100075024 (CHRNA4)
Ion channels [BR:oaa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100075024 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 100075024
NCBI-ProteinID: XP_001506577
UniProt: F7DET6
Position
8
AA seq 624 aa AA seqDB search
MGSLGRPGPFALLLCALALPACCHIETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVR
FGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQDYENVTSIRIPSELIWRPDIVL
YNNADGDFAVTHLTKAHLFYDGRVKWMPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD
KAKIDLVSMHSHVDQLDYWESGEWVIINAVGNYNIKKYECCTEIYPDITYSFIIRRLPLF
YTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPL
IGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHSMPAWVRRVFLDVIPRLLFMKRPAVVK
NNCKKLIESMHKIASAPRYWPEPEGELNFATSSSNSPQSQEETPSPSVRIHLEDPANPPP
ICKSPSGPVKDDGPSPSASCHPLSDAQSPGLPKTRSLSVQQMHSPGKVEEGGIRCRSRSI
QYFYLQEDSSQTNGQSQVNGQSRSSPASLRSHLNRDQQQIKPSPCRCKCKKNKAPASPDP
GAKSQSRSTKEQHHLLMSPALKLAVEGVQYIADHLRAEDADFSVKEDWKYVAMVIDRIFL
WMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgctcggacgcccgggacccttcgccctcctcctctgcgccctcgcccttccc
gcctgttgtcatatagagactcgagcccatgctgaggagcggctcctgaaaaaactcttc
tctggctataacaagtggtctcgtccagtggctaacatctccgatgtggttctggtccgg
tttggattgtccatcgcgcaactcattgacgtggatgaaaagaatcaaatgatgaccacc
aatgtttgggttaagcaggaatggcatgactacaaacttcgctgggatccccaggactat
gagaatgtcacctccatccgcattccctctgaactcatctggaggccggacattgtcctg
tacaacaatgcagacggggattttgcagtgacacacctgaccaaagctcacctcttctat
gacggaagagtcaaatggatgcctcccgcaatctacaagagctcctgcagtattgatgtg
actttctttccctttgaccagcaaaactgcaccatgaagtttggctcctggacctacgac
aaagcaaaaatagacctggtgagcatgcacagccacgtagaccaactggactactgggag
agtggagaatgggtcatcatcaatgccgttgggaactacaacatcaagaaatatgaatgc
tgcaccgaaatttaccctgacatcacctactccttcatcattaggaggcttcctcttttc
tataccatcaatctcatcattccctgtcttctgatttcttgcttgactgtcttggtcttc
tacctgccttccgagtgtggtgaaaagatcaccctatgcatttcagtgctgttgtctctg
actgtgttcctcctcctcatcacagagatcattccttctacctccctggtcattcccctg
attggagagtacctgcttttcaccatgatctttgtgaccctgtctatcatcatcactgtc
tttgtgctcaacgtccaccatcgatctcctcgcacccactccatgccggcctgggtccga
agagttttcctggacgttattccccgcctcctcttcatgaaaaggcctgctgttgtgaaa
aataactgtaagaaattgattgagtccatgcacaaaattgccagtgccccaaggtattgg
cctgagcctgaaggggaactcaactttgctacctcatcttccaacagcccacagagtcag
gaggagactccctctccttctgttcgcattcatctggaggatccagcaaacccccctccc
atctgcaagtcgccctctggtcccgtgaaggatgatggtccctctccttcagcctcctgc
caccctctaagtgatgcccagtcccccggtctccctaaaaccagatctctaagtgtccag
caaatgcacagccctgggaaagtggaggaagggggcattcgctgtaggtcaagaagcatt
cagtatttttatctccaagaagattcttcccagacgaacggacagtcccaagtcaatggc
caatccagaagctcccctgcctctctacgcagccacctcaacagagaccagcagcagatc
aagccttcaccttgcaggtgcaaatgtaagaagaacaaagctccagcctctccggaccca
ggtgccaaatcacaatcacggagcaccaaagaacagcatcatttgctgatgtcgccagcc
ttgaagctcgcagtggagggcgtccagtacatcgcagaccatctgagggcagaggatgct
gatttttcggtgaaagaagactggaaatacgtcgccatggtcatagacaggatcttcctc
tggatgttcatcattgtttgcttattgggcactgtgggacttttcctgccgccttggctg
gcgggaatgatttga

DBGET integrated database retrieval system