KEGG   Ornithorhynchus anatinus (platypus): 100075245
Entry
100075245         CDS       T01045                                 
Symbol
TTLL3
Name
(RefSeq) tubulin monoglycylase TTLL3
Organism
oaa  Ornithorhynchus anatinus (platypus)
SSDB
Motif
Pfam: TTL GSH-S_ATP
Other DBs
NCBI-GeneID: 100075245
NCBI-ProteinID: XP_007665610
Position
X1:complement(91537175..91543383)
AA seq 935 aa
METGRGASWTLRSDPVSKHLYEEADGEAEGAARFRTDLRAVGQRLNLRPPKGREDKVLPT
HPSGTSRGQPSGVTVVREEDTTASPKDKECSPHDEGADQAAQRLGRARPHVGPRGRQFGS
SNEQSGFPALRPAGQDAVPRPRLSISRFDNIKEQVEQAIKQNKIFLIIGSFPLIKTLLRQ
RGWVEKKLSWPIRQASASQERIVNEDVEGSRPTKGDESRISSCVSSTLCWTNVQERARMG
VGCLQGRTGSTLWPLYPHFEPEEIVECSWVQNFMARLVQNEIPYFIWTARRDVVDFRTLR
KEQMTNHYASPGSFTTMIGLCLNLRNLPSLDEANADVFFPRCYQLGIDDEKDTFIEDFWL
TAARSVLKLVVEAAWEPLEENLAQLLKAHARKAPADSRTKNGRRERRDSVRLIEEALKIC
DDHLSYLAHQNTEGGQKTLLGMNLGQIDNFLQRYYKVVQEGLAVEPTKVHIQRCKDLLQQ
LKKWVSQLAMEGDQNMWILKPGMNSRGQGFVCLDKLDDILKLVHDNLTAVKAGKWMVQKF
IERPMLIFGRRFDLQQWFLVTDWNPLIIWFYCDNYICFSTQTFSLHNQDMSGHLINYSIP
PHLINSQRHHPALPKDNMWSSREFQEHLQELGVLGAWTSVMQPGMKAALIHTLQSSQDSA
PLRKNSFELYGARFIFGEDFQPWLIKINANPSLEPWNALTNQLFTVLQTDILRVVIDSQN
DPSCNIGGFELIHCQPPVETTDYKGLPPLVEGTPVEKPSLPQLDPAESSEGAAGSPFLEA
HGVPKGQSSMMSPLAKSHHKKSSRSSRKPGSSTKSEMAAAATRKDEKVEAATGRVPTQSY
PRIGDLPHTTVSWFNTAATTWGKEQESLKPHPLDTHHPHRALAKEKENLKAKVPSRSRNW
SPLPFLTNPSLPNLRSDPQKSSTDGKAPKSNFTQR
NT seq 2808 nt   +upstreamnt  +downstreamnt
atggaaacagggcggggggcgagctggactctgcgtagcgatccggtctccaagcacctt
tatgaggaagctgacggggaggcagagggtgcagcccgattcaggacggatctcagagcc
gtcgggcagaggctgaacctgaggcctccgaaggggagggaagataaagtccttcccact
catcccagcggcacgagccgtggccagccttctggcgtgactgtggttcgggaggaagac
accacggccagtccaaaggataaggagtgcagcccccacgatgagggtgctgaccaggcg
gcccaacggctgggccgggccaggccccacgtaggcccgagagggcgtcagtttggctct
tccaatgagcagtcaggctttccggcccttcggccggctgggcaggacgctgtccccagg
ccccgtttgagcatatcccgattcgataatattaaggaacaagtagagcaagcaatcaag
caaaacaagatcttcctgatcatcggctccttcccactcatcaagaccctcttgcgccag
cggggctgggtggagaaaaagttgtcctggccaatccgtcaggcctcagcaagccaggaa
agaatagtcaatgaggacgttgagggcagcagacccactaagggtgatgagagtcggata
tccagctgtgttagctccactctctgctggacgaacgtccaggagagggcaaggatggga
gtggggtgcctccagggaagaaccggctccacactttggcccttgtacccgcacttcgag
cccgaggagatagttgaatgtagttgggttcaaaactttatggcccgtctggtccagaat
gagatcccctacttcatctggacagcccggcgggatgtggtagatttccgtacgctccgt
aaggagcagatgacaaatcattatgccagtccaggctctttcaccaccatgattgggctc
tgtctcaacctccggaatctcccctcgttggatgaagctaatgcagacgtgttcttccca
cgctgctatcagttggggatcgacgatgaaaaagacactttcattgaggacttttggctg
acggcagcacgctccgtcctcaagctagtagtagaggcagcgtgggagccacttgaggaa
aatctggcccagctgcttaaggctcatgcccgcaaagctccagcggacagtagaaccaaa
aacggcagaagggagcgccgtgattctgttcggttgatcgaggaagccttgaagatctgt
gatgaccacctcagctacctggcacatcagaacacagaaggaggccagaagaccctgctg
ggcatgaacctgggccaaattgacaactttctgcaacgttactacaaggtggttcaagag
gggttagccgtggagccgaccaaagttcacatccaacgctgcaaagatctcctgcagcaa
ctgaagaagtgggtttcccagctggcaatggagggagatcaaaacatgtggattttgaag
cccggtatgaactccaggggccaagggttcgtgtgcttggataagttagacgacatccta
aagctagtacacgacaacttaacggctgtcaaggcaggcaaatggatggtgcagaagttc
atcgaacgacccatgctcatcttcggtagaagatttgacctccagcagtggttccttgtc
acagactggaacccactgataatctggttctactgtgataactacatctgtttttcaacg
cagaccttctcactccataaccaagacatgtcaggacatttaatcaactactcaatcccc
ccccacctgataaacagtcaaagacatcaccctgcacttcccaaggacaacatgtggtcg
tcacgggaatttcaagagcatttgcaggaactaggagtcctgggagcctggaccagtgta
atgcaaccaggaatgaaagcagcgttaattcatactctccagtcctcccaggattctgca
cctttacgtaaaaacagctttgagctctatggtgcccgttttattttcggggaagatttt
caaccctggctcattaagatcaacgcgaacccctctctagaaccttggaatgctctgacc
aaccagctctttacggtgctgcagaccgacatcctgcgtgtggttatcgactctcagaac
gacccgagttgcaatatcggtggctttgaactcattcattgccagccacccgttgagacc
accgactacaagggattgccgcctctggtagaaggaaccccagtcgagaaaccaagcctt
ccccagttagatcctgctgagtcatcagaaggggctgctggctctccgttcctcgaagcc
catggggtgcccaaaggccagtcctcaatgatgtcacccctagccaaaagccaccataaa
aaaagttctagaagttcaaggaagccaggctcctccacaaaaagtgaaatggcagcggca
gccaccaggaaggacgaaaaagttgaggccgccaccggccgagttccaacccagtcgtac
cctcgtataggagatctgccacacaccactgtgagttggttcaacaccgctgctaccacc
tggggcaaggagcaggaatccctgaagccccacccactggatacacatcaccctcacagg
gccttggctaaagagaaggaaaacctgaaggcgaaagtgccgtcccggtctagaaactgg
agcccactccctttcctgacgaaccccagcctgcctaacttgagatcagatcctcagaaa
tcatcaactgatggcaaagcaccaaaaagtaacttcacccaacgctaa

DBGET integrated database retrieval system