KEGG   Ornithorhynchus anatinus (platypus): 100075305Help
Entry
100075305         CDS       T01045                                 

Gene name
GSS
Definition
(RefSeq) glutathione synthetase isoform X1
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00270  Cysteine and methionine metabolism
oaa00480  Glutathione metabolism
oaa01100  Metabolic pathways
oaa04216  Ferroptosis
Module
oaa_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100075305 (GSS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100075305 (GSS)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100075305 (GSS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oaa04147]
    100075305 (GSS)
Enzymes [BR:oaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     100075305 (GSS)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100075305 (GSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 100075305
NCBI-ProteinID: XP_028935996
Position
15
AA seq 500 aa AA seqDB search
MATSWAATLAEGPQLEELAAQAADRALVEGVLMRTEDSPGSSHVVSYAPFTLFPSAVPRA
LLEQAYAAQADFNRLLDAVSRSPAFLERTLASTIKMDDFVAQLFSIYKQVLKEGLAQTVF
LGLNRSDYMFHRGADGPPALKQVEINTIAASFGGLSSKTPAVHRHVLAVSGKPEEAAEVL
PNNPSKGLARGIAKAWELYGCSGAVVLLVAQEKERNIFDHRYVEYELAARNIRVIRCTFE
DVSERAALDKDRKLFLDGREIAVVYFRDGYMPAQYSPQNWEARLLLERSRAVKCPDIATH
LAGTKKVQQELSRPGVLETLLPGQTESIARLRATFVGLYSLDLGSWRKTKKDRPEIQEEK
RERTVSEAEGEEGDRAVARALAAPARFVLKPQREGGGNNLYGEEMKRELERLKGSAERAS
YILMDKIEPEPFRACLLRPGAPVRLADCVSELGIFGVYVRRGDELLVNEHAGHLLRTKAV
EHADGGVAAGVAVLDNPYPV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccagctgggccgccaccttggccgaagggccccaactggaggagctggcggcc
caggccgccgaccgtgccctggtcgagggcgtgctgatgcggaccgaggactcgcccggc
tcgtcccacgtggtgagttacgccccgttcacgttgttcccgtcggcggtgccgagggcc
ctgctggaacaggcctacgcggcgcaggccgacttcaaccggctcctggacgccgtcagc
cgcagcccggccttcctggagcggacgctggccagcaccatcaaaatggatgacttcgtt
gctcagctcttcagcatctacaagcaggttctgaaggagggtctcgcccagacggtgttc
ctgggactgaaccgctccgattacatgttccaccgcggcgccgacggccccccggccttg
aagcaggtggagatcaacactatcgccgccagcttcgggggtctctcctccaagaccccc
gccgtccatcggcacgtgctcgccgtgtcgggcaagccggaggaggcggccgaagtcctt
cccaacaacccaagcaaagggctcgcgcggggcatcgccaaggcgtgggagctgtacggc
tgctccggggctgtcgtgctgctcgtcgctcaggagaaggaaaggaatatatttgaccac
cgctatgtggagtatgagctggctgcccggaatatccgggtgatccggtgcacgtttgaa
gatgtctctgaaagagcggctttggataaggaccgaaagctgttcctggacggccgggag
atcgccgtggtctacttccgggacggctacatgcccgctcagtacagccctcagaactgg
gaggcccggctgctgctggagaggtcgcgtgccgtgaagtgtccggacatcgccacccac
ctcgccgggaccaagaaggttcagcaggagctgagccgccccggggtcctggagacgctg
ctgcccggccagacggagtccatcgcgcggctccgggccaccttcgtgggcctctattcc
ctggacctggggagttggcgaaagaccaagaaggaccgaccggagatccaggaggagaag
cgggagaggacggtcagtgaagccgagggggaagaaggagaccgggcggtagctcgggcc
ctcgcagccccggcccggttcgtcctcaagccccagagggagggcggaggcaacaacctg
tacggggaagagatgaagcgagagctggagaggctgaagggcagcgcggagcgggcctcc
tacatcctcatggacaagatcgagcccgagcccttccgggcctgcctgctgcggcccggg
gcccccgtccgcttggccgactgcgtctcggagctcggcatcttcggggtctacgtcagg
cgcggtgacgagctgctggtcaacgagcacgcggggcacctcctccgcaccaaggccgtg
gagcacgcggacggcggggtggccgccggggtggccgtcctggacaacccgtacccggtg
tga

DBGET integrated database retrieval system