KEGG   Ornithorhynchus anatinus (platypus): 100075318Help
Entry
100075318         CDS       T01045                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00561  Glycerolipid metabolism
oaa01100  Metabolic pathways
oaa04714  Thermogenesis
oaa04723  Retrograde endocannabinoid signaling
oaa04923  Regulation of lipolysis in adipocytes
Module
oaa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100075318 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100075318 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100075318 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100075318 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oaa01002]
    100075318 (MGLL)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100075318 (MGLL)
Peptidases [BR:oaa01002]
 Serine Peptidases
  Family S33
   100075318 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Peptidase_S9 Abhydrolase_3 Lipase_3 DLH Abhydrolase_2 PGAP1 LIDHydrolase Abhydrolase_5 Thioesterase DUF1350
Motif
Other DBs
NCBI-GeneID: 100075318
NCBI-ProteinID: XP_007666504
Position
Un
AA seq 338 aa AA seqDB search
MTMFSKMPEENSPRQTPQNIPYQDLPHIVNADGQYLFCRYWKPTCAPRALVFISHGAGEH
SGRYEDLAQMLIGLDLLVFAHDHVGHGQSEGERMIVSDFHVFIRDVLQHVDFMQKDHPGL
PIFLLGHSMGGAISILTASERPGHFAGMVLISPLVVASPESATTFKESGLAAGGIRGMIK
STSAVAAQWTPIAIWVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDSYNADSLVCHAGL
KVCFGIQLLNAVSRVERALPKLTLPILLLQGSADRLCDSKGAYLLMEAAKSQDKTLKVYE
GAYHVLHKELPEVTSSVFQEIKAWFSQKTGSAGTSSNP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgttctccaagatgcctgaagaaaattctccaaggcagactccccagaacatc
ccttaccaagaccttcctcatatcgtcaatgcagacgggcagtatctcttctgcaggtat
tggaaaccaacctgcgcaccaagggccctcgtgtttatctctcatggtgccggggagcat
tctggccgctatgaagatttggctcaaatgctgattggacttgacttattggtgtttgct
catgaccatgttggccatgggcagagcgaaggcgaacggatgattgtgtccgatttccat
gttttcatcagggacgttttgcagcatgttgacttcatgcagaaagatcaccctgggctc
cctatcttcctcctggggcattccatgggaggagccatctccatcctaacagcatcagag
agacccgggcactttgcaggcatggtgttaatttctcctcttgttgtcgccagccctgaa
tcagcgacgacatttaaggagtcgggtttggcagcgggcggcataagaggcatgatcaaa
tcgacatcggcagtagcggctcaatggaccccgatagccatttgggttctggccgccaaa
gtgctcaatctggttctcccaaacctgtctctggggccaattgattccagcgtgctgtcc
cggaataagacagaggttgactcttataatgccgattccctggtttgccacgcagggctt
aaggtttgctttggcatccagttgctgaatgccgtgtcccgagttgagcgagccctcccc
aaactgaccctgcccatcctgctgctgcagggttctgccgacaggctctgcgacagtaag
ggggcctacttactgatggaagcagccaagagccaggacaaaacgctgaaggtgtatgaa
ggggcctaccacgtcctccacaaagagctccctgaggtcaccagctcagtcttccaggaa
ataaaagcgtggttctctcaaaagacaggatcagctggaacctcctccaacccctaa

DBGET integrated database retrieval system