KEGG   Ornithorhynchus anatinus (platypus): 100075535Help
Entry
100075535         CDS       T01045                                 

Gene name
MTMR14
Definition
(RefSeq) myotubularin-related protein 14 isoform X1
  KO
K18086  myotubularin-related protein 14 [EC:3.1.3.64 3.1.3.95]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00562  Inositol phosphate metabolism
oaa01100  Metabolic pathways
oaa04070  Phosphatidylinositol signaling system
oaa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100075535 (MTMR14)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100075535 (MTMR14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100075535 (MTMR14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oaa01009]
    100075535 (MTMR14)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100075535 (MTMR14)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100075535 (MTMR14)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100075535 (MTMR14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 100075535
NCBI-ProteinID: XP_028907200
Position
X1
AA seq 634 aa AA seqDB search
MAGARAPPFLPQEPGLGELLEEFSRAQYRAKDGSGAGSAKIERIEKKCLELFGKDYCYSL
IQNVNGEICGHYPRHIVFLEYESSEKDKNTFESTVQVSKLQDLVNRSKLARCRGRFVCPV
ILYKRKHICRSATLAGWGELYGRTGYNYIFSGGSDDIWADTEDVTEDCALRNADSQLFDK
VRGHDIKLLRYLSVRYICDLMVENKKVKFGLNVTSSEKVDKAQRYADFTLLSIPYPGCEF
FKEYKDRDYMAEGLIFNWKQDYVDAPLNIPVSLTRSLNIDWSEYQCWDLVQQTQNYLKLL
LYIVNTEDESGLLVHCISGWDRTPLFISLLRLSLWADGLIHATLQPAEILYLTVAYDWFL
FGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSVLKTQRRKSLSARDPGFSLEEICMLERR
DRGSTTSLSSDFSLVMESSPGAAGSFTYEAVELLPAGAQTQAAWKKNRTSSPQTVLWTRS
QQPEDKMPNQGVAEAKSSSSSSSNHSENFFRIGSSPLEVPKPRSVDHSLPGSSISTDFGS
WQMVSGCGSIQEQAVLNPDSSLPLSFPDELPNSCLLTALTERESRLEEVRSAFLATYSRT
VGLKSVTSSPSGAIGGLLEQFVRGVGLRGTSSTL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgctcgggctccccctttcctgccgcaggagcctgggctgggggagttgcta
gaggagttctcccgggcacagtatcgggccaaggacggtagcggagcaggcagtgccaag
atcgagcggattgagaagaaatgcctagagttgttcggcaaagattactgctacagtctg
atccaaaatgtgaacggggagatatgtggccactacccccgccacattgtgttcctagaa
tatgagagctctgagaaggacaaaaacacatttgagagcaccgtgcaagtgagcaaactg
caggatcttgtcaaccgcagcaagttggccagatgtagaggacggtttgtctgcccggtc
attctgtacaagagaaagcatatttgcaggtcggcaaccctggctggatggggagagctc
tatggacgcactgggtataattacattttctcagggggctcagatgacatttgggctgat
acagaagatgtcacagaagattgtgcacttagaaatgcagattcccagcttttcgataag
gttagaggccatgacatcaaactacttcggtacctgtcggtcagatacatctgtgacctg
atggtggaaaacaagaaagtgaagtttggcctgaatgtgacctcctccgagaaggtggac
aaggcccagcgttacgccgatttcactctcctctcgatcccgtatccaggctgtgagttt
ttcaaggagtataaggatcgtgactacatggctgaggggctcatttttaactggaaacag
gactacgttgatgctccgttaaatatccctgtctctctgacccgctctctgaacattgac
tggagcgagtaccagtgctgggacctggtgcaacagacccaaaactacctgaagctgctg
ctttatatcgtcaacactgaggatgagagcgggctgctggtgcactgtatatctggctgg
gatcgaacacctctcttcatctccctccttcgcctttccttgtgggccgatggcctaatc
catgcaaccctgcagcctgcagagattctctatctgactgtggcctatgactggtttctc
tttggacacatgttggtagatcgactcagcaaaggggaggagattttcttcttctgcttc
aattttttgaagcacatcacctctgaagagttctctgttctgaagacacagagaaggaag
agtttgtcagctcgggaccctggcttttccctggaagaaatctgcatgctggaacggagg
gaccggggcagcacgactagtctgagcagtgacttttctctggtaatggagagctcacct
ggagcagctgggagtttcacctacgaagctgtggagctcctaccagcaggagcacaaaca
caggcagcttggaagaagaaccgcacttcttctccccagaccgtgctctggacccggtcc
cagcagccagaagataagatgcccaaccaaggggtggcagaagccaagtcttctagttct
tcctcctctaatcattctgagaactttttcaggatcggaagcagtccgctagaggtccct
aaacccagatcagtggaccattccttgcccggatcctccatctctacagactttggcagc
tggcagatggtatcggggtgtggcagtattcaggagcaggcagtcctgaacccagactcc
tctctccctctcagcttcccggatgaactccctaacagttgcctactcacagcactgacc
gagcgggagtctcggctggaggaagtacgctcagcctttttggccacctacagcaggaca
gttggcctcaaatcagtgacttccagcccatcgggggcaatcggtggccttctggagcag
tttgtacggggtgttggacttcgaggaaccagtagcaccctatga

DBGET integrated database retrieval system