KEGG   Ornithorhynchus anatinus (platypus): 100075723Help
Entry
100075723         CDS       T01045                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase 2-like, mitochondrial
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00010  Glycolysis / Gluconeogenesis
oaa00620  Pyruvate metabolism
oaa00640  Propanoate metabolism
oaa01100  Metabolic pathways
oaa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100075723
   00620 Pyruvate metabolism
    100075723
   00640 Propanoate metabolism
    100075723
Enzymes [BR:oaa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100075723
Lipid biosynthesis proteins [BR:oaa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100075723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 100075723
NCBI-ProteinID: XP_001507198
Position
Un
AA seq 509 aa AA seqDB search
MAEQAIPVPRSLGLLLLGLADRLPGIWWHWMNCLDRHVQRSPDKVALIWERDEPGTEVRV
TYRELLDITCRLANILKKHGVSRGDRVALYMPVSPLAVAAMLACARVGAVHTVIFAGFSA
ESLAGRINDAKCKVVITANQGLRGGRVIELKKIVDEAVKNCPSVKCVLVVQRTDNKVPMG
NLDILLEDEMTQASAVCPPESMDSEDMLFLLYTSGSTGSPKGLVHTQAGYLLYAALTHKH
VFDYREGDVFGCVADIGWITGHTYVVYGPLCNGATTVLFESTPIYPNAGRYWETVQRLKI
NQFYGAPTAVRLLLKYGDDWVKKYDLSSLRTLGSVGEPINQEAWDWLYHVVGDGRCTLVD
TWWQTETGGICIAPRPSEEGAEIRPAMAMRPFFGISPTLIDEKGKVMEGGNISGALCISQ
PWPGMARTIYGDHQRFIEAYFNAYPGHYFTGDGAFRTSEGYYQITGRMDDVINISGHRLG
TAEVEDAMANHPSVPESAVIGYPHDVKGE
NT seq 1528 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggcaattccagtcccgagatccctgggcctgctgctgttgggtcttgct
gacaggctgcctggcatctggtggcactggatgaactgcttagatcggcatgtccaaagg
tccccggacaaagtggctttgatctgggagagagatgaacctggaaccgaagtgagagtc
acatacagggaacttctggacatcacgtgccgcctcgccaatattctgaaaaaacatggg
gtgagccgtggggacagagtggccctgtacatgcctgtgtctcctttggcggtggcagcc
atgctggcttgtgcccgggtcggggctgtgcacacggtgatctttgctggattcagcgcc
gagtctttggctggacgaatcaatgatgcaaaatgcaaagtggtcatcactgccaaccag
ggcctgagaggaggccgagtcattgagctgaagaagatagtggatgaagccgtaaaaaat
tgcccttcagtcaagtgtgtcctggtggttcagaggacagacaacaaagtgcccatgggg
aatctggacatcctcctggaagatgagatgacccaagcaagtgcagtgtgtcctcccgag
tccatggacagtgaagacatgctgtttctgctttacacttcagggagcacaggctcacca
aaggggctggtccacactcaagctggatacttgctttatgctgctctgacccacaagcat
gtctttgactaccgggaaggggatgtgtttggctgtgtggcagatatcggttggatcacg
ggacacacttacgtggtatatgggccactctgcaatggagccaccacagtcctgtttgag
agcactccaatatacccaaatgcaggtcgatactgggaaactgtgcagaggttaaaaatt
aaccagttttacggtgctcccactgctgtgcgactgctactgaaatatggagatgattgg
gtgaagaagtatgatctgtcttccttaagaactttgggatcagtcggagagccaattaac
caggaggcttgggactggctgtaccacgtggtgggagatggccggtgcacactggtggac
acctggtggcaaacagaaacagggggaatttgcatcgccccgcgaccctcagaggagggt
gccgagatccgtcctgctatggccatgaggcccttcttcgggatctccccgaccttgata
gatgagaagggaaaagtcatggaaggtgggaacatctctggtgccctgtgcatctcccag
ccttggcctggcatggcaagaaccatctatggagaccatcagagattcatcgaagcatac
ttcaatgcctacccaggccattacttcactggggatggtgccttcaggacctccgagggc
tattaccagatcaccggaaggatggacgatgtcatcaacatcagcggccatcgcttgggg
acggcagaggttgaagatgccatggccaaccacccatctgtgccagaatcagcagtgatt
ggttatccccatgacgtcaagggagaag

DBGET integrated database retrieval system