KEGG   Ornithorhynchus anatinus (platypus): 100075832Help
Entry
100075832         CDS       T01045                                 

Gene name
PLK2
Definition
(RefSeq) serine/threonine-protein kinase PLK2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100075832 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oaa01001]
    100075832 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oaa03036]
    100075832 (PLK2)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100075832 (PLK2)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100075832 (PLK2)
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100075832 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     100075832 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    100075832 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 100075832
NCBI-ProteinID: XP_028929799
Position
10
AA seq 687 aa AA seqDB search
MELLRTITYQPAASAKVGEQALGKACTGESKKKPQQQQPEEQQLQQLQQQAPPAALHHHH
HHHHSHSSAEISRIIIDPGTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRV
AKPHQREKIDKEIELHRILHHRHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLT
EPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRR
TICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYT
MPSSLLAPAKHLIASMLSKNPEDRPRLDDIIRHDFFLQGFTPERLSSSCCHTVPDFHLSS
PAKNFFKKAAAALFGGKKEKARYFDAHNRLAKEDEEIYKLRHDLKKASITQQPHKHRTDE
EIQPPNMTVVKSGAPATDHKQPIGDSIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARV
LRGCLENMPEADCIPKEQLTTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLL
PDKKTVHYYAELGQCSVFPATDAPEQLISQVTVLKYFSHYMEENLMDGGDLPSVTDVRRP
RLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIILCSQSDEYLLTYINEERISTTIRLT
TLLISGCSLELKNRMEYALNMLLQRCN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggagttactgcggactattacctaccagccggctgccagtgccaaggtgggcgagcag
gcgctgggcaaagcctgcacgggggagtccaaaaagaagccgcagcagcagcaaccggag
gagcagcagctgcagcagctgcagcagcaggcccccccggctgccctgcaccaccaccac
caccatcaccactctcactccagcgccgagatctccaggattatcatcgatcccggcacg
ggcaagcgctactgccggggcaaggtgctgggcaagggtggctttgcgaagtgctatgag
atgaccgacttgacaaacaacaaagtttacgctgcaaaaatcattccacacagcagggta
gccaaacctcatcaaagggaaaagatcgacaaagaaatagagctgcacagaattcttcat
caccggcatgtggtgcagttctaccactactttgaggacaaagaaaatatttacattctc
ctggagtactgcagtaggcggtctatggctcacatcttgaaagcaagaaaggtgttaacc
gaaccagaagtgcgatactacctcaggcagatcgtgtcaggactgaagtaccttcatgag
caagaaatattgcatagagaccttaagctaggtaacttcttcatcaatgaagccatggaa
ttgaaagtgggcgactttggcttggcagctcggctggaacctttggagcacaggagacgg
acaatatgcggcacaccaaactatctctcacccgaagtgctcaacaaacaaggacatggc
tgtgaatcagacatttgggccttaggctgtgtaatgtatacgatgctcttgggaagaccc
ccgtttgagacaaccaatctaaaagaaacctacaggtgtataagggaagccaggtacacc
atgccctcatccttgctggccccagcgaaacacttaatagccagcatgctgtccaaaaac
ccagaggatcgccccaggctggatgacatcattcgacatgacttcttcttgcagggcttc
acaccagaaagactgtcctcaagctgctgccatactgtgccagacttccacttgtcaagc
ccagctaagaacttctttaagaaggcagcggctgctctctttgggggtaaaaaggaaaaa
gcaagatacttcgatgcacataacagactggctaaagaggatgaagaaatttacaagctt
aggcatgacttgaagaaggcttccataacccagcaaccccacaaacacagaacagatgag
gagatccaaccacccaatatgaccgtggtcaagtctggagcgccggcaacagatcacaag
cagccaatcggggattccattaggatgatagtgagaggaactctgggtagctgcagcagc
agcagcgaatgtctggaggacagtactatgggcagtgtggctgacacagtggcaagggtt
ctgaggggatgccttgagaatatgccagaggccgactgcatccccaaagagcagctgacc
acgtcctttcagtgggtcaccaaatgggtagattactcgaataaatacggctttgggtac
cagctgtcggatcacacagtcggggtcctcttcaacaacggggcccacatgagccttctc
cctgacaaaaaaacagtccactactatgcagagcttggccagtgctcagtgtttcctgct
acagatgctcctgaacagttaattagccaagtcacggtgctgaaatatttctcacactac
atggaggagaatctcatggatggcggagacctgcctagtgtcactgatgttcgcaggccc
cggctctacctcctccagtggctaaaatctgataaggccttaatgatgctgttcaacgat
ggcacatttcaggtgaacttctaccacgatcatacgaaaataatcctctgcagccagagc
gatgagtatctactcacttacatcaacgaagagaggatctccacgacgatccggctgact
actttactgatctctggatgctcgctggaactaaaaaatcgaatggaatatgcactgaat
atgctgctgcaacgctgtaactag

DBGET integrated database retrieval system