KEGG   Ornithorhynchus anatinus (platypus): 100075875
Entry
100075875         CDS       T01045                                 
Symbol
MAGI2
Name
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 isoform X1
  KO
K05629  atrophin-1 interacting protein 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04015  Rap1 signaling pathway
oaa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100075875 (MAGI2)
   04151 PI3K-Akt signaling pathway
    100075875 (MAGI2)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 MAGI_u1 WW Peptidase_M50 Guanylate_kin DUF6288 MAGI_u5 TFIIA
Other DBs
NCBI-GeneID: 100075875
NCBI-ProteinID: XP_028933338
Ensembl: ENSOANG00000015075
Position
13:complement(26160953..27063742)
AA seq 1522 aa
MSKSSRKKSHWTSRVHESVIGRNQQGQLGFDLRGGAEHGQFPYLGEVRTGQVVYNSGTKL
VAEELLLEVNETPVAGLTLRDVLAVIKHCKDPIRLKCVRQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLFNVTDQILPGATPSAEGKRKRNKSVSNMEKAGIDPPEEEEEEGP
MVNGNGEVAIPETSEHEEKSSGASGDIPSQPYPAPMYSQPDESKEDMDVAKPAKPEENDE
LGSLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQNNMPTTELGPKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLALMERVPPLAVNG
RHNYETYLEYISRTSQPVPDVADRPPHSLHSIPADSQLDGPFPPPAVHDDNVSMASSGAT
QAELLTLTIVKGTQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVQINQQNAHNLSH
TEVVDILKECPVGSETSLIIHRGGFFSPWKTSKPIMERWENQGSPQTSLSAPAIPQNIPF
PPTLHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQKVPPRTSFRADSSGLDYKELDV
HLRRMESGFGFRILGGDEPGQPILIGAVIASGSADRDGRLHPGDELVYVDGIPVAGKTHR
YVIDLMHNAARNGQVNLTVRRKVPPVGESCPENGRSPGSVSTHHSSPRSDYTTYANSNHA
APNSNASPPEGFSSASLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIID
GSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELSSPASAP
SSEKQSPMAQQQQQQQQQQQSPLAQQQQQQQQQQQSSPVAPTSPISQPPLPQPLQLQGHE
NSYRSEVKARQDVKPDIRQPPFTDYRQPSTDYRQPPLDYRHPPGVDYQQPPPLDYRQPPL
IDYRQHSPDTRQYPLSDYRQQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLFVLRLAE
DGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEP
NSWSSPPATSPGLPEVAVSLEDIISPLSSSHLAPPSDPPHQRNPDPTWENRRGPDAGIPK
ELPANGQKKKRLGEQRERSTSPKKVDRSRHEEAPRKGLSEGRSQRAEGGRQASENPAPGW
RTSAEIGTGEPGAAGADDERRGRLKMAEALRGGSPGKRDDPGGLGTEKRAAMANDPSRLE
PLGATKAHGSGSGGLHRNGTGPVPQEPGGKPCDCPGKSHFHPSSGRQAATARKTTVSPGP
WKIPGSDKLPSALKSSPSAASR
NT seq 4569 nt   +upstreamnt  +downstreamnt
atgtccaagagctcgaggaagaaaagccactggacgagccgggtccacgagagcgtcatc
ggccgcaaccagcagggccagctgggcttcgacctgcggggcggcgcggagcacggacag
ttcccctacctgggggaggtgcgcaccggccaggtggtctacaacagcgggaccaagctg
gtggccgaggagctgctgctggaagtcaacgagacccccgtggcggggctgaccctcagg
gacgtgctggccgtcatcaaacactgcaaggaccccatccggctcaagtgcgttcgccaa
ggaggaattgttgataaggatctccgtcactacctcaatttacggttccagaaaggatcg
gtggatcacgagcttcagcaaatcatacgggacaacctttacctccgcacagtaccatgc
accacaaggccacataaagagggagaggtcccaggagtggactatatattcattaccgtt
gaagattttatggaactggagaaaagtggagccctcttggaaagtggaacctatgaagat
aactactacggcaccccaaagcccccagcagagccggctcccttgctcttcaatgtaaca
gaccagatccttccgggagccacaccgagcgcagaggggaaacgcaagaggaataagtcc
gtgagcaacatggagaaggctggcattgaccctccggaggaggaggaggaagagggaccc
atggtgaacggaaatggagaagtggcaataccagagacaagtgagcatgaagagaagagt
tcaggtgcctcaggagacattccctcccagccttatcctgcaccgatgtacagtcagcca
gatgaatccaaggaggatatggatgtagcgaagccagcgaagcctgaggagaatgatgag
ctgggctccctgcccgataactgggagatggcctacacggagaagggggaagtctacttc
attgaccacaacacaaagacaacatcatggctggatccacgtcttgcgaaaaaggctaag
cctcctgaagagtgcaaagaaaatgaacttccatatggctgggagaaaattgatgatcca
atttatggcacttattatgttgaccacataaatagaaggacacagtttgaaaacccggtc
ctggaagccaaaaggaagctacagcagaataacatgcccaccacggagcttggcccgaag
cctctacaggcccccggctttcgagaaaagccacttttcacccgggatgcatcacaactg
aaaggaacttttctcagcacaaccctgaagaagagcaacatgggatttgggtttaccatc
atcggtggtgatgaaccagatgagtttctgcaggtgaagagcgtcattcctgatggaccc
gcagcccaagatgggaaaatggagacaggtgatgtaattgtctatatcaacgaagtgtgt
gtcctcggacacactcacgcagatgtggtcaaactcttccagtcggtccctattggccag
agcgtgaacctggtgctgtgccgtggatacccactgccctttgaccccgaagatccagcc
aacagcatggtgccgccccttgcgttaatggagcgggtccctccactggcggtcaacgga
aggcataactacgagacgtacctggaatacatttctaggacgtcgcagcctgtcccagat
gtggccgatcgaccaccccattctttgcactccatcccagcagacagtcagctcgatggt
ccgtttccacccccagcggtccacgatgacaacgtatcgatggcttcttcgggggctacc
caagctgaacttttgaccttaaccattgtgaaagggacccagggctttggcttcactatc
gcagacagtcccaccggacagagggtgaagcaaattctagacattcagggatgccctggc
ttgtgcgaaggcgacctcattgttcagattaaccagcagaatgcacacaacctgagccat
acggaggtagtggatatacttaaggagtgtcctgtgggaagtgagacatctctgattatc
cacagaggagggtttttttctccttggaaaacttcaaagcctataatggagcgatgggaa
aaccaaggcagtccccagaccagtctatctgccccggccatccctcagaacatccccttt
cctcccaccctacaccggagttcctttccagactccacagaggccttcgacccccggaaa
cccgacccgtacgagctgtacgagaaatcaagagcaatttatgaaagtaggcagaaagtg
ccacccaggaccagttttcgagcggattcctctggtctggactacaaggaattggacgtt
caccttcggaggatggagtctggatttggctttcgaatcctaggaggagatgaacccgga
cagccgattctgatcggagcagtgatcgcgtcgggctcagcggacagagacgggcggctg
caccctggtgacgagctggtctatgtggatggcatccccgtggcgggcaagacccatcga
tatgtcattgacctcatgcacaacgcggcccgcaatggccaggtcaacctcaccgtcagg
aggaaggtgccgcctgtaggggagtcctgtcccgagaatggaaggagcccaggttcagta
tcaacccaccacagctccccacggagtgactacactacttacgccaacagcaaccacgct
gcccccaacagcaacgcctcgccccccgaaggcttctcctcagccagcctgcagaccagc
gacgtggtcatccaccgaaaggagaacgaaggtttcggcttcgtcatcatcagctccctc
aacaggcctgagtccggagcaacgataactgtaccccataaaattgggcgaatcatcgat
ggaagcccggccgatcgctgtgccaaactcaaagttggagaccggatattagctgtgaat
ggccagtctatcatcaacatgcctcacgcagacatcgtgaagctcattaaggatgcaggc
cttagtgtgaccctccgcatcattcctcaggaggagctgagcagccctgcgtcagccccc
agctcggagaagcaaagccccatggcccagcagcagcagcaacagcagcagcagcagcag
agtccactggcccagcagcaacagcagcagcagcagcagcagcagagcagccccgtggcg
cccaccagtcccatctcccagccccctctaccacagccgctccagctccaagggcacgaa
aacagttataggtcagaagtgaaagcgaggcaggatgtgaagccagacatccgacaacct
ccgttcacagactacaggcagccatccacagactacaggcagccacccttggactacagg
cacccgcccggtgtggactaccagcagccaccgccactagattacaggcagccaccgctg
atagactaccggcaacactctcctgacactcggcagtatcctctctcagactaccggcag
cagccccaggattttgattatttcaccgtggatatggagaaaggcgccaaaggatttgga
ttcagcattcgtggaggacgggaatacaagatggatctttttgtgttgaggttggcagaa
gacgggccggcaataaggaacggaaggatgagggtgggagatcagatcattgaaatcaat
ggggagagtacgcgggacatgacccacgccagagcaatagaactcatcaaatccgggggt
cggagagtgcggctcctgctgaaacgtggaacgggacaagtcccagaatatgacgaacca
aactcctggagctctccccctgccacctccccaggtctgccggaagtagcggtttccctg
gaagacataatctcaccattatcttcatcgcatctagccccaccctctgaccctccccac
cagagaaacccagatcccacatgggagaacaggcggggacccgacgcaggaataccaaag
gagcttccagccaatggccagaagaagaaacggttgggagaacagagagagagatccacc
agtcccaagaaagtcgacaggtcaaggcacgaggaggcccccaggaagggtctctccgag
ggtaggtcccagagagctgagggtggccggcaggcctcagagaatccggcccctggatgg
aggacctcggccgagattgggacgggagagccgggggctgctggagccgacgatgaacga
cgtgggaggctcaagatggccgaagccctccggggagggtcccccgggaaaagggacgac
cccggagggctgggcaccgagaagagggcagccatggccaatgatcccagccggctcgag
ccacttggggccacgaaggcgcatgggagcgggagcggtggccttcaccggaacggcacg
ggccccgtcccccaggagccgggcgggaaaccctgcgactgcccggggaagagtcatttc
catcccagcagtggtcgccaggcagccaccgcccggaagacgaccgtctccccggggcct
tggaagatccccggttctgacaagcttccgagcgcactgaaatccagcccttcggccgcc
agtagataa

DBGET integrated database retrieval system