KEGG   Ornithorhynchus anatinus (platypus): 100075957
Entry
100075957         CDS       T01045                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oaa03021]
    100075957 (AFF3)
Transcription machinery [BR:oaa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100075957 (AFF3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 100075957
NCBI-ProteinID: XP_028904069
Position
20
AA seq 1194 aa
MDSFDLALLQDWDLDSLCVYEPDRSALRKKERERRNQESQQDGTTFNTSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGGPQTPADKADDDLIPASGPQP
FLRGSSSSTVVAVPEPQLKKPSAGWQKAGPTLSADHQKPNEHGHRLLDSHAIDLKTASQK
TSGETSKYCATSPTSSRSSSNPAQQGPQRAALGDGASRQQPQRPKADCTVGARLRPPERP
MSTKHGRSGNFPSSLPSKTSGVQRKPTAYVRPMDGQDQTPSESPKLKSSMEPSLHCAPCG
GEPANKPDSGKTRPRLAKFNIAKHGEDGGSGDSGCVKEILRDSQHVSTGHLIQKKCDTEP
KSQDHDTSCSSMLEDDLKLSSDDEENEQQAAQRSPLRVLADSGTVQPPSPRASQPPGGGV
SSDSGSSSDSDSSSGSDSESESSSGESEHPDPPRFSSPEPEQASSNKWQLDKWLNKVNSQ
KPPVLHQNEGSGPGSGQCYGRLKDDGSGCVQAAEGQPAGLKDKEIKTPSKQEQRPRTASK
APGARTGRQKSPPALATAATAGPALAAAGAGAPLRRSAWKKQLGRTEKPPASHGLGCPRA
EAAGGSQGLLDGNPTEPPKRRLVSNRTGSGKERRASVAWEKRRLRGPGRTAPKSKEFIET
ESSSSSSSSSSSSSSSSSSSSSSSSASSSSDTDPESDRDGLPGPRGGAEPGPELEEQSYT
LVPFGRNELLSPLKDGDDVKALWVKIDLALLSRVPGASPEDGRMESNPQRPAPDPPAGKV
LPRSKRKRKCENEEEIRESKKTQGDKACSLRSTAPAKSPPSGNHCSLNVNSSATPMNKNE
KAAWSPISPLSDASKHQHSSSDLTSPCRPNGNSLLTSISSSQKPRPETKSPTHPADFSKA
VHTNSENALVCNKSQPPMEPWSPSHNSHRDKRRQKLVFDAMPHTADYFMQEAKRMKHKAD
AMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSSPN
ATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAPQAPSPWGASGK
STGIPSPMSPSPSPVSSVGSQGSLSSSGAPSPTSIISIPQRIHQMAANHVSITNSILHSY
DSWEMADNLAKENREFFNDLDSLMGPVTLHSSMEHLVQYTQQGLRWVRSRTYVS
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggacagcttcgacctggccctgctgcaggactgggacctggactcgttgtgtgtctat
gaaccagaccgaagtgcgctgcggaagaaagaacgggaaaggaggaatcaggagtctcag
caggacggtaccacttttaatacaagttattccctcttcagtgaaccgtataagacgaac
aagggggacgagctctcgaatcggatccagaacactctgggcaactatgacgagatgaaa
gacctgctgacggacagatccaatcagagccatctcgtcggagttcccaagccggggggt
cctcagaccccagccgataaagcggacgacgatttgatcccggcctccgggccgcaaccc
tttctccgtggctcttcgtcttccacagtggtcgccgtgccagagccacagctcaagaag
ccctcggcaggttggcagaaagccgggcccacgctttctgctgaccaccagaagccaaac
gaacatggccaccgattgctcgattcacacgctattgacttgaaaaccgccagccaaaaa
accagtggtgaaacgagtaaatactgtgcaaccagtcccacgtcctcccgctcttcctcc
aacccagcacaacaaggtccccagcgggcagcacttggggacggggccagtagacagcag
cctcagaggcccaaggccgactgcaccgtgggcgcccgcctgcggcctccagaaaggccc
atgtcgaccaagcacggcaggagtgggaacttcccatcttcccttccgtcgaagaccagc
ggagtccagcggaagccaacggcttacgttcggccgatggatggccaggatcagactccc
agtgagtctcccaaactaaaatcctccatggaaccgagccttcactgtgccccatgcgga
ggagagccagctaacaaacctgactcgggcaagaccaggccaaggttagcaaagttcaac
atcgccaaacacggggaggatggtggatccggagacagcggctgtgtgaaagaaatattg
cgggactctcagcatgtatccaccggacaccttattcaaaagaaatgcgacaccgagcca
aagagtcaagaccatgacacctcgtgctcatcaatgctagaagatgacctcaagttaagt
agtgacgacgaagagaatgagcagcaggcagcacagaggtctcctctccgcgttctagct
gacagtggcacggtccagcctcccagccccagagcctcccagccgcccggcgggggagtc
agcagcgacagcggcagctccagcgactcggacagcagctcgggatccgactcggaaagc
gagagcagttctggggagagcgaacaccccgaccctcctcgcttctccagcccagagccg
gaacaagcgtcctctaacaagtggcagctggataagtggctgaacaaagttaattcccag
aagcccccggttctccaccaaaatgaaggctccggtccagggagcgggcagtgttacggt
aggttaaaggacgacgggtcagggtgtgtccaagctgctgagggccagccagctggcctc
aaagacaaggagatcaagacccccagcaagcaggagcagaggcctaggacagccagcaaa
gccccgggcgcccgaacggggaggcagaaatcgccgccagctcttgccaccgcggccacc
gccggcccggctctcgctgcggccggtgccggtgccccgctgaggagatcggcctggaag
aagcagctcgggaggacagagaagccccctgctagccacggcctcggctgccccagagcc
gaggccgcaggcggaagccaagggctcttggacggcaaccccaccgaacccccaaagcgc
agattggtcagcaaccgaacgggatcggggaaggagcggcgtgcctcagtggcctgggag
aaacgccggctccggggccccggccgaacagcccccaaatccaaagaattcatcgagaca
gaatcctcgtcctcctcctcgtcctcgtcgtcctcctcctcctcgtcctcctcttcttcc
tcctcttcctcgtccgcctcctcttcctcggacacggaccccgagtcggatcgggacggg
ttgcccgggccccggggcggggccgagccaggcccggagctggaggagcagtcctacacc
ctggttcctttcgggaggaatgaactactgtcgcccctgaaggacggcgacgacgtcaag
gcgctgtgggtcaaaatcgacctggctcttctatccagggtcccgggggcctcccctgag
gacgggaggatggagagcaacccccagagacccgcccccgacccaccggcgggcaaggtc
ttgccaagatccaagcggaaacgcaagtgtgaaaacgaagaggaaatcagggagagtaag
aagactcagggagacaaggcgtgttccttacgatccactgctccggccaaaagccctcca
tcaggaaaccattgcagcttgaatgtcaatagctcggcaacaccaatgaataaaaatgag
aaagcggcctggtcacccatctcacccctctccgacgcgtcaaaacaccaacactccagc
agtgatttaacctctccctgtagaccgaatggcaacagtctattaacttccatctcctcc
agccaaaaacccaggcccgagaccaagtcgccaacccatcctgcagatttctctaaagct
gttcacaccaactcagaaaatgcgctagtctgcaacaagtcccagcctccaatggaacca
tggtcaccgtcacacaacagccacagagacaaaaggagacaaaagctagtcttcgatgct
atgccacacactgcagattattttatgcaagaggctaaacggatgaagcataaagcagat
gcaatggtggagaaatttgggaaggccctgaattatgcagaagcagccctgtcatttatt
gagtgcggaaatgctatggaacagggccctatggaatcgaaatccccctatacaatgtac
tcggaaacagttgaactcatcaggtatgccatgagactcaagacccactccagccccaac
gccactcccgaagacaaacagctggcggcgttatgttaccgctgcttggcactcctctac
tggcggatgtttcggctcaaaagggaccatgccgtgaagtattcgaaagccctgattgac
tacttcaagaattcttcaaaagctccccaggccccatctccttggggcgccagtggaaag
agcacaggaattcccagccccatgtctcccagcccgtctccggtcagctccgtgggatct
caggggagtctctccagcagcggagccccttcgccgacgtctatcatcagcatcccccag
cgcatccatcagatggcagccaatcacgtcagcatcaccaacagcatcctgcacagctat
gactcctgggagatggccgacaacctcgccaaggagaacagagagttctttaacgatctg
gattcactcatgggacctgtcaccttgcacagcagcatggagcatctggtgcagtacact
cagcagggactgcgctgggtccggagcaggacttacgtctcgtag

DBGET integrated database retrieval system