KEGG   Ornithorhynchus anatinus (platypus): 100076457Help
Entry
100076457         CDS       T01045                                 

Gene name
NMNAT1
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00760  Nicotinate and nicotinamide metabolism
oaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100076457 (NMNAT1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     100076457 (NMNAT1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     100076457 (NMNAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 100076457
NCBI-ProteinID: XP_028921251
Position
5
AA seq 333 aa AA seqDB search
MIRLQRLAARFKLSLFKTCSCDTKVFRADQRPQGQTMEDPDRTEVILLACGSFNPITNMH
LRLFELAKDYMNETGKYRVVKGIISPVGDAYKKKGLISAHHRVTMIKLATQTSKWVEVDD
WESRQNEWIETAKVLRHHHQNLATSNGNDSLQDSAPPTKHGRKRKWSKDSQDSNEKNPPR
RENKGALELKLLCGADLLESFGIPNLWKKEDITEIVSNYGVVCVTRAGNDAEKFIYESDL
LWRHRSNIHLVNEWIPNDISSTKIRRALRRGRSIRYLVPEPVREYIEKHGLYSSESEDRN
AGVILAPLQKHSQEARQREILELGLAASAQGVK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtttacagaggcttgcagcacgattcaagttgagtctatttaaaacctgtagc
tgtgacaccaaggttttccgggcggaccagcggccacaaggacagaccatggaagatccg
gacaggacggaggtcatcctcctagcctgcggctccttcaacccgatcaccaacatgcac
ctccgactgttcgagttggccaaggactacatgaatgaaacagggaaatacagagttgtt
aaaggcatcatttccccagttggcgatgcttacaagaagaaaggactcatcagtgcccat
caccgggtgactatgatcaaacttgccacccagacttcaaaatgggtggaggtggatgac
tgggagagtcgtcagaacgaatggatagagacggcaaaagtgctgcgccaccatcatcag
aacctggcgactagcaatggtaacgatagcctgcaggactcggctcctccgaccaaacat
ggcaggaagaggaagtggtctaaagacagccaagactccaatgaaaagaatccaccccgt
cgggaaaacaaaggagcgttagagctgaaattactctgcggggcagatttgctggagtcc
tttgggattcccaacttgtggaagaaggaggacatcaccgaaatcgtgtccaactacgga
gtcgtatgtgtcacgcgggctgggaacgacgccgagaaattcatctacgagtcagacttg
ctgtggcgacacaggagcaacatccacctggtgaacgagtggattcccaacgacatctcg
tccaccaagatccgccgagccctccgcaggggccggagcatccgctacctggtcccggaa
cccgtgcgggagtacatcgagaagcacggcctgtatagttcagaaagcgaagacaggaac
gccggggtcatcctggcccctctgcagaagcactcccaagaagccaggcagcgagagatt
ctggagcttggcctggccgcctccgcccaaggcgtaaagtga

DBGET integrated database retrieval system