KEGG   Ornithorhynchus anatinus (platypus): 100076543
Entry
100076543         CDS       T01045                                 
Symbol
FAR1
Name
(RefSeq) fatty acyl-CoA reductase 1 isoform X1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    100076543 (FAR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100076543 (FAR1)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     100076543 (FAR1)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 3Beta_HSD Semialdhyde_dh GDP_Man_Dehyd KR
Other DBs
NCBI-GeneID: 100076543
NCBI-ProteinID: XP_028915805
Position
3:40219033..40300518
AA seq 539 aa
MVSIPEYYEGKSILLTGATGFLGKVLLEKLLRSCPQVKSVYVLVRQKAGQTPQERVEELL
SGKLFDRLKDENPEFKEKIIAVNSELTQPKLALSEEDQETIIDSVNIIFHCAATVRFNES
LRDAVQLNVIATRQLILLAQQIKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDS
LEWMDDGLVNDITPKLIGDRPNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPF
PGWIDNFNGPSGLFIAAGKGILRTMRASNSALADLVPVDVVVNTSLAAAWYSGVNRYTRP
RNIMVYNCTTGSTNPFHWGEVEYHVISTFKRNPLEQAFRRPNVNLTSNHLLYHYWIAVSH
KAPAFLYDVYLRITGRSPRVPGLIGPPDDPKGNDANQSIGMMKTITRLHKAMVFLEYFTS
NSWVWNTDNVNMLMNQLNPEDKKTFNIDVRQLHWAEYIENYCMGTKKYVLNEEMSGLPAA
RKHLNKLRNIRYGFNTILVILIWRIFIARSQMARNIWYFVVSLCYKFLSYFRASSTMRY
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggtttcgatcccagaatactacgaagggaagtctatcctcctcactggagctaccggc
ttcttggggaaggtgcttctggagaagttattgagatcgtgtcctcaggtgaagtccgtg
tacgtgttggtgaggcagaaagccgggcaaacccctcaagagcgagtggaggaattactc
agcgggaagctctttgacagattgaaagatgaaaatcccgaatttaaagagaaaatcata
gcagtcaacagtgaactcacacaacccaaactggccctcagcgaagaagatcaagagacc
atcatcgattctgttaatattatattccactgtgctgctaccgtccgattcaatgaatcc
cttagagacgccgttcagttaaacgtgattgcaacccgccagctcatcctcctcgcccag
caaataaagaatctggaagtgttcatgcatgtgtccacggcttacgcgtactgcaatagg
aagcatattgacgaagtcgtctaccctccgccggtggaccccaagaaactcatcgattcc
ctagaatggatggacgacggccttgttaacgatatcactcccaaactgataggcgacaga
cccaacacatatatttacaccaaagccttggcggagtacgtcgttcaacaggaaggggct
aaactcaatgtggccatcgtaaggccatcaatcgtcggagccagttggaaggagcctttc
ccgggatggatcgataacttcaacggacccagtggcctcttcattgctgcagggaaagga
atccttcgaacaatgcgagcttccaacagtgccctcgccgatctcgttcctgtggatgtc
gtggtgaacaccagcctagcagcagcctggtattctggagttaataggtataccagacca
agaaacatcatggtgtataactgtacgacgggtagcaccaatcctttccactggggtgaa
gttgaataccatgtaatttccactttcaagaggaatcctctcgaacaggctttcaggcgg
cccaatgtaaatctaacctccaatcaccttttatatcattattggattgctgtgagccat
aaggccccagcattcctgtatgatgtctacctcaggattacaggaagaagtccaagggtc
cccgggctaattggacctccagatgatcctaaaggaaatgatgccaatcagtccataggg
atgatgaaaacaataactcgtcttcataaggcgatggtgttcctagagtacttcacaagc
aactcttgggtgtggaatactgacaatgtcaatatgttaatgaaccaactgaaccccgaa
gataaaaagacatttaatattgatgtgcgacagttgcactgggcagaatatatagaaaac
tactgtatgggaactaagaaatacgtgttgaatgaagaaatgtctggtctccccgcagct
agaaaacacctgaacaagttgcggaacatccgttacggcttcaatactatcctcgtgatc
ctgatctggcgtatttttattgcgagatcacaaatggcgcgaaacatctggtacttcgtg
gttagtctgtgttataagtttctgtcctacttccgagcatccagcactatgagatactga

DBGET integrated database retrieval system