KEGG   Ornithorhynchus anatinus (platypus): 100076606
Entry
100076606         CDS       T01045                                 
Symbol
NEO1
Name
(RefSeq) neogenin isoform X1
  KO
K06766  neogenin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04350  TGF-beta signaling pathway
oaa04360  Axon guidance
oaa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100076606 (NEO1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100076606 (NEO1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100076606 (NEO1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_5 Tissue_fac fn3_2 SusE TMEM154 EphA2_TM Herpes_UL74 Ly49
Other DBs
NCBI-GeneID: 100076606
NCBI-ProteinID: XP_028920996
Ensembl: ENSOANG00000001009
Position
5:complement(46249013..46519478)
AA seq 1485 aa
MAAQPGALRLPTPATTSSSSTTASSLWISCLLLLPLLGSGAARTSSQPQLPGASVRTFTP
FYFLVEPEDTLSIRGSSVILNCSAYAEPSPKIEWKKDGTSLNLASDDRRQLLPDGSLLIN
SVVHSKHNKPDEGYYQCVATVEGLGTIVSRTAKLTVAGLPRFANQPESSSVYAGNGAVLN
CEINADLVPFVRWEQDRQPVLLDDRVIKVLNGALIISNASEEDGGLYRCVVESGGPPKYS
DEAELKILSDPEVPSKLIFLKPPVPTIRVTGQTAVLPCVASGFPTPTIRWTRNEEALITE
GSEKLALLAGGSLEINDIVEEDAGIYTCIADNGNETIEAKADLTVQVPPEFLKRPTNIYA
HESMDILFECEVNGKPTPTVKWVKNGEMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIA
ENDVGNAQAGAQLIILDHDVAIPTLPPTSLTSATTDHLAPATTGPLPSAPRDVVASLVST
RFIKMTWRTPASDPHGDNLTYSVFYAKEGVNRERIENTTRPGEMQVTIQNLMPETVYIFR
VVAQNKHGSGESSAPLKVETQPEVQLPGPAPNIRAYATSPTSTTVTWETPLSGNGEIQNY
KLYYMEKGTDNEQDVDVGSRSYTINGLKKYTEYSFRVVAYNKHGPGVSTEDVVVRTLSDV
PSAAPQNLTLEVRNSKSIMIQWQPPPPGTHNGQITGYKIRYRRISRKSDVTESIGGTQLF
QLIEGLERGTEYSFRVAALTVNGTGPATDWVSGETFESDLDESRVPEVPSSLHVRPLVTS
IVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFN
NVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRIT
WADNSLPKHQKITDSRYYTVRWKTNIPANTKYKTANATTLNYLVTGLKPNTLYEFSVMVT
KGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIY
YSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPK
ADSSDKMPNDQASGSAGKGNRLPDTDYKTPMGGNNSPHGSPTSPLDSNMLLVIIVSVGVI
TIVVVVIVAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPI
DKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRP
KMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPTRSYLHHQVNPWPVGTSMSHSD
RANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATGSSYLASSQEEDSGQSLPTAHVRP
SHPLKSFAVPAVPPPSSTYDPALPSTPLLSQQAPNHQVHSVKTASIGTLGRTRPPMPVVV
PSAPEVQETTRMLDDSESSYEPDELTKEMAHLEGLMKDLNAITTA
NT seq 4458 nt   +upstreamnt  +downstreamnt
atggcggcgcagccgggagccctgagactccccacccccgccaccacctcctcgtcctcc
accaccgcctcctccctctggatctcctgcctgctcctgctgccgctcctcgggtcggga
gccgccaggaccagctcccagccccagcttccaggggctagcgtcagaacattcactcca
ttttattttttggtggaaccagaggatacattatcaatccgagggtcttctgttatactg
aactgttcagcatatgcagaaccttctccaaaaattgaatggaaaaaagatggaacttct
ttaaacctagcctcagatgaccggcgccagcttcttcccgatggatctttattaataaac
agcgtggtgcattctaaacataataaacccgatgaaggatattatcaatgtgtggctaca
gtggagggtcttggaaccatcgtaagcagaacagcaaagctcacagtagcaggtcttcca
aggtttgccaatcagccagaatcatcatctgtctacgcaggaaatggtgcagttcttaac
tgtgaaatcaatgctgatttggtccccttcgtaagatgggagcaagaccgtcagccagtc
cttttggatgacagagtaatcaaagtcctgaatggagctctgattatcagcaatgcttca
gaggaagatggaggactttatcgttgcgtggttgaaagtggtggtccacctaagtatagt
gatgaggcagagctgaaaatcctttcagatcccgaggttccatcgaaattgatattcctg
aagccaccagttcccaccatcagagttactggtcaaactgcagtcttgccatgtgttgct
tctggatttccaactccaactattaggtggactagaaatgaggaggcactaatcacagaa
ggctctgaaaaattggcgctgctggcaggagggagtctagagatcaatgatattgtggaa
gaagatgctgggatctatacctgcatagctgataatggaaatgagacgattgaggctaaa
gcagaccttacagttcaagttccaccggaattcctaaagaggcctaccaacatatacgcc
catgagtccatggatattttattcgaatgtgaagtgaatgggaagccaactccaactgta
aaatgggtcaaaaatggggaaatggtgattcccagtgattacttcaagattgtgaaggaa
cataacctgcaggttttgggtctggtgaaatccgatgaaggattctatcagtgcattgct
gaaaatgatgttggaaatgcccaggctggagcccaactgataatacttgatcatgatgtt
gccatcccaacattacctcccacttcactgaccagtgccactactgaccatctagcacca
gcaacaactggaccactgccttcagctcctcgggatgtcgtggcctccctcgtctctact
cgtttcatcaaaatgacgtggcggacccctgcatctgatcctcatggagacaacctcacc
tactcagtgttttacgccaaggaaggtgtaaatagggaacgcattgaaaatactactcgg
ccaggggaaatgcaagtgacaatccaaaatctgatgccagagacggtctatatcttcaga
gtagtggcgcaaaacaaacatggatctggagaaagctcagccccattaaaggttgaaacc
cagcctgaagttcagctccctgggccggcaccaaacattcgagcttatgctacttcacct
acctcaacaactgttacatgggaaacaccattgtccggcaatggtgaaatccagaattac
aagctgtattacatggagaaagggacagataatgagcaggacgttgatgttggcagccga
tcctacactattaatggcttgaaaaagtatacagagtacagtttccgtgtggtggcctac
aataaacacggtcccggagtctccaccgaagatgttgttgttcgaacattatcagatgtt
cccagtgctgcaccacagaacctgaccttagaagtgagaaactccaagagtatcatgatt
cagtggcagccccctcctccagggacacacaatggtcaaattactggatataagatccgc
taccggagaatctctcgcaagagtgatgttacggagagcattggaggaacacaacttttt
cagttaattgagggtcttgagcggggtactgaatacagcttccgagtggctgccctaaca
gtcaatggtacaggacctgccactgactgggtgtcgggagaaacatttgaaagtgatctg
gatgaaagtcgggttcctgaagtgccaagttcccttcacgtccgcccccttgttactagt
attgtagtgagctggactcctcctgaaaatcagaacattgtagtgagaggatatgctata
ggatacggcattggcagccctcatgcacagacgattaaagtggattataagcaacgttat
tacaccattgaaaatttagatccaagctcccattatgtcataaccctcaaagcatttaac
aatgttggtgaaggaatcccactctatgaaagtgcagtgaccaggcctcatacagatact
tctgaagttgatttatttgttattaatgctccatacactccagtgccagatcccaccccc
atgatgccaccggtgggagttcaggcttccatattgagccatgataccataaggatcacg
tgggcggacaactctctgccaaagcaccagaagatcacagattcccgctactacacggtc
cgctggaaaactaacatccctgcaaacaccaaatacaagactgccaatgcaaccacattg
aactacttagtgactgggttaaagccaaacactctctacgaattttctgtgatggtgact
aaaggtcgaagatcaagtacgtggagtatgacagcccatgggacaacctttgaactagtt
cctacttctccaccaaaagatgtgactgttgtgagtaaagaggggaaacctagaaccata
attgtgaactggcaacctccttcagaagctaatggcaaaatcacagggtacatcatttac
tacagtacagatgtgaatgctgaaattcatgactgggttattgagcctgtagtaggaaac
agattgacccaccaaatccaagagttaacccttgatactccatactactttaaaatccaa
gcccgcaactctaagggcatggggcccatgtcggaagcagtgcagtttagaacacctaaa
gctgactcctctgataaaatgcctaatgatcaagcttcaggatctgcaggaaaaggaaat
cgactacctgatacagactacaaaacaccaatgggcggtaataatagcccccatgggagt
cccacctcacctctagatagcaatatgcttctagtcattatagtttctgttggcgtcatc
actattgtggtggtcgtgattgtggctgtcttctgtactcgtcgtaccacctctcaccag
aaaaaaaaacgggctgcttgcaaatcagtgaatggatctcataaatacaaaggaaactcc
aaggatgtcaagcctccagacctttggatccatcatgagagactggagctaaaacccatt
gataaatccccagacccaaaccccatcatgactgataccccaatccctcgcaactcccag
gatatcacgccagtagataattctatggacagcaatatccatcaaagacgaaactcttac
agagggcatgaatcagaggacagcatgtctaccctggcaggaagacgaggaatgagacca
aaaatgatgatgccatttgactcacagcctccccagcctgtgattagtgctcatcccatc
cattcactcgataaccctcaccatcatttccactccagcagcctcgcttctccgacccgc
agctatcttcatcatcaggtcaacccatggcctgttggcacttccatgtcccattcagac
agggccaattccacagagtcagttagaaatacacccagtacagacaccatgccagcgtcc
tcatctcagacatgttgtactgaccatcaagatccagaaggtgccacaggatcctcttac
ttagccagctcccaggaggaagattcaggccaaagcctgccaactgcccatgttcgtcct
tctcaccctctgaagagttttgctgtgccagcagtgccacccccaagttccacatacgac
cctgcattaccaagcacaccgttactgtcccagcaagctcctaaccatcaagttcactca
gtgaagacagcatcgattggcactcttggaagaacccggcctcctatgccagtggtagtt
cccagtgctccagaggtgcaagaaaccaccaggatgcttgatgattcagaaagtagttac
gaaccggatgagctgaccaaagaaatggcccacctggaaggactaatgaaggaccttaat
gccatcacgacagcgtga

DBGET integrated database retrieval system