KEGG   Ornithorhynchus anatinus (platypus): 100077268
Entry
100077268         CDS       T01045                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oaa01002]
    100077268 (ADAMTS13)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100077268 (ADAMTS13)
Peptidases and inhibitors [BR:oaa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100077268 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN Reprolysin_4 TSP1_spondin ADAM_spacer1 Reprolysin_5 Reprolysin_3 Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 100077268
NCBI-ProteinID: XP_028919038
Position
4
AA seq 1557 aa
MNHQGLSDLIALRPHRLDSVSFHPLVMTSTWVILSSALFFWGSCRPLSDFHEEFLTALDP
EDVFTYFGSISVREVPEFDLAQLSCLCEDQRPGLPCKAQRCSFRALGGFYALRFPEELSL
LGPSFVSERAVNGTLSLLKRFPDNCFAGGRVLLPRQADAKVTLCSGRLQGDILVNGEQLH
IQPVRTEHWSPRPDGHQVHPHLIHRVGRRTRAPEAFRPRPRIWKRAPGSIRHLELMIVVG
PDVYRIHGEDTERYILTNLNIGAELLRDVSLGAQLRVHLIKMMVLTEPEAGPNISTNISS
SLLSVCEWSRKVNPPDDTDPQHADLVLYITRFDLELPDGNKQVRGVTRLGEACSPAWNCL
ITEDTGFDLGVTIAHEIGHSFGILHDGTESGPCGGSNSIMASEGDPDSVDLTWSECSREQ
FLNFVSTGQASCVDDLPEQDGSIPGGEPGLYYGADEQCRIAFGSSAVACTFATSDADMCK
VLSCHANSLDQTSCSRLFVPLLDGTECGVNKWCSKGRCRSLEELDPVSVVHGEWSGWGAP
SPCSRSCGGGVVTRRRRCNNPRPAFGGRGCEGADLQAELCNTQACSKTQLDFMSEQCAAT
DLQPLHIPPGLPAFYRWTSAAQYSQGDALCKHMCWAAGENFIVSRGESFQDGTRCEPSGP
QEEGTLSLCVMGSCRVFGCDGRMDSRQVMDVCQVCGGDNSTCSGVNGSYAEGRAGEYVTF
LTIPPNLTAVHVVNRKPLFTHLAVKVRGQYVVAGKTRISLNVTYPSVLEDSRIAYKLFLT
EDKLPRLEEIHIAGPTWEVIEIQVYRKYGREYGNVTNPDIAFSYFQPTTRPAWAWAAVAG
VCSVSCGEGVRLVSYGCFDRTGRELTDAARCGGTPRPLPRQEPCAPGACPPSWAAGDFGP
CSALCGGDGVREREVRCLHKKGSLVLTLPDAACGASPRPAATEPCRAGPCPARWKVSAWS
RCSSACGPGVSQRNVTCVRVRAGLETSAGDGLCSGEEKPPHLMPCLLATCSPAWGAPKTE
SSREEAVTSPSADRKNGTEGIWSPVGGPCSVSCGQGLMELRYVCVDFATGEEVREAWCEA
VRKPGRRLEVCRAAPCPPSWRYKLDSCSVTCGGGIRRRILYCAGGSGEEEEVVADAQCRG
PPRPVEQEPCNPEPCLARWTVTATGPCSSSCGPGAADRTVKCVRLRHGRESAVDEAACAG
EARPPASVPCNVAPCTYRWQFSDWTECSVSCGNGIQLRHDFCIKPPTLRPVPAFFCQHVP
KAPTVRRCSPGPCPRETGPSLAPRGAAAAPAPVETAAAGSPEDPRDPAPDLLRPPLPSAP
GPLEPPGRRDLEESRACGKHHLGATGTINMTGTRATADCTVAIGRPLGEVVVLHVLESSL
NCSAGDMLLIAGRLSWRKACRQLTGMIVGSRTNTLMVRQRRVLAGSGVVLRYWSQAATDG
YHRECDVQLFGPKGEITSPPLRPGLENRGRCRIFIDVAPQARIAIHALAINLPAGASRTR
ASYISIRDTPLMKTTTFYGQQLFYWESVGSQAEIEFGESFRDDHTGFRGQYWTLKSR
NT seq 4674 nt   +upstreamnt  +downstreamnt
atgaaccaccagggactgagtgatttaatagccctaaggccgcaccgtttggacagtgtg
agcttccatcccctcgtgatgaccagcacatgggtgatcctttcctccgctctcttcttt
tggggctcctgccgacctctttcagacttccacgaggagtttctgacggctttggacccg
gaagatgttttcacgtattttggttccatttctgtccgggaagtgccagagttcgacttg
gctcaactcagctgcctctgtgaagaccagcgtccggggctgccctgtaaggcccaacgc
tgctcattccgggccctgggggggttctacgccctccgcttcccagaggagctcagcctc
ctgggcccctccttcgtcagcgagcgggcggtgaacggcaccctgagtctgctgaagcgc
ttccccgacaactgctttgccggcgggagagttctgctgccccgccaggcggacgccaag
gtcactctctgctcgggccggctgcaaggggacatcctggtaaatggggagcagcttcac
atccagccggtgaggacggagcactggagcccgcggccagacggccaccaggtccacccc
cacctcatccatcgggtggggagaagaacccgggccccggaagccttccggccccggccg
cggatctggaaacgggccccggggagcatcagacacctggaactgatgatcgtcgtcggc
cccgatgtctaccggatccacggggaggacacagagcggtacatcctcaccaacctcaac
attggggcagaactgctgagagacgtttctctgggagcccagttgcgagttcacctgatc
aagatgatggtgttgacagagcccgaggccggtccgaacatcagcacaaacatctcctct
tcgctgctgagcgtgtgcgagtggagcaggaaggtcaaccccccggacgacacggaccct
cagcatgccgatctcgtactgtacatcaccaggtttgacctggagctgcccgacgggaac
aagcaggttcgaggggtcactcggctcggagaggcctgctctcccgcctggaactgcttg
atcaccgaggacacgggctttgacctgggggtcaccatcgcccacgagattgggcacagc
ttcggaatccttcacgacgggaccgagagcggcccctgcggcgggagcaacagcatcatg
gcttcggagggcgaccccgacagcgtcgacctcacctggtccgagtgcagccgggagcag
ttcctgaacttcgttagcacagggcaggcaagctgtgtggatgacctgccggagcaggat
ggcagcatccccgggggagagcccggcctgtactacggagccgacgaacagtgcaggatt
gccttcgggagctcggccgtggcctgcacctttgccacgagcgacgctgacatgtgcaag
gtcctctcctgccacgcgaactccctggaccagaccagctgtagccgtcttttcgtccct
cttctggatggaaccgaatgtggggtcaataagtggtgttccaagggccggtgtcgctct
ctggaggagctggaccccgtgtccgtggtgcatggggagtggtccggctggggtgccccc
agcccctgttcccgcagctgtggcggaggagtggtgaccaggaggcggcggtgcaacaac
cccagaccggccttcgggggacggggctgcgagggggccgacctccaggcagaactgtgc
aacacccaggcctgttcgaagacccagctggacttcatgtctgagcagtgtgctgcaacc
gatcttcagccgctgcacatccccccggggctcccggctttctacaggtggacttcggct
gcccagtacagccaaggggacgccctgtgcaagcacatgtgctgggcggctggggagaac
ttcatagtgagccgtggagagagtttccaggacggaacgcggtgcgaaccgagtggaccc
caggaggaggggaccttgagtctctgcgtgatggggagctgcagggtgttcggatgcgac
ggcagaatggactcccggcaggtgatggacgtctgccaggtctgtgggggagataacagc
acgtgcagcggagtgaacggctcttacgctgagggaagagccggagagtatgtcacgttc
ctgaccatccctcccaatctcaccgccgtgcacgtcgtcaaccggaagcctctcttcaca
catttggccgtgaaggtgagagggcagtacgtggtggccggaaagacgcgtatctcgttg
aacgttacgtacccctcggttctggaagacagccggatcgcgtacaagttgttcctcacc
gaggacaagctgccccgcctggaggaaattcacatcgcgggacccacttgggaagtcatc
gagatccaggtttacaggaagtatgggagagagtacggaaacgtcaccaatccggacatc
gccttcagctacttccagccgacgacgaggccggcgtgggcgtgggccgcggtggccggg
gtctgctcggtgagctgtggggaaggggtcaggctggtgagttacggctgcttcgaccgg
accggccgggagctgaccgacgctgcccgctgcggagggacgcctcggcctctgccccgg
caggagccctgtgccccaggggcctgcccgccgagctgggcagcgggggacttcggcccc
tgcagtgccctctgcggcggcgacggcgtgagggagcgggaggtccgctgcttgcacaag
aagggcagcctggtgctgacacttcccgacgccgcgtgcggagcttctccccgtcccgct
gccaccgagccctgccgggccgggccctgccccgccaggtggaaggtgtctgcgtggagc
cggtgttcttcagcttgcggcccgggcgtgtcccagaggaacgtgacctgcgtacgtgtc
cgggctggcctggaaacctccgccggagacggtctgtgctccggggaagagaagcccccg
cacctgatgccgtgcttgttggccacttgttccccggcctggggtgctccgaaaacggag
tcctcaagggaggaggcagtcacgtcccccagtgccgacaggaaaaatggcacggaaggc
atctggagccccgtgggcgggccgtgctccgtctcctgtggccaaggtctgatggagctg
cggtacgtctgtgtggattttgccaccggggaagaggtccgggaagcgtggtgtgaggcg
gtgagaaaaccggggcgccgtctggaggtctgccgcgctgctccgtgcccccccagttgg
aggtacaagctggactcgtgcagcgtgacctgcggtggagggatcaggcggaggatcctg
tactgtgccgggggcagcggggaagaagaggaggtggtggccgacgcccagtgccggggc
ccgcctcgcccggtggagcaggaaccgtgcaacccggagccgtgccttgccaggtggacg
gtgacggccaccggcccgtgctcctccagctgtggcccgggagcggccgaccgcacggtg
aagtgcgtgcggctgcgtcacggccgggagtcggcggtggacgaggcggcgtgtgcgggg
gaggccaggcctccggctagcgtcccctgcaacgtggccccctgcacttaccggtggcag
ttcagcgactggacggagtgctccgtctcttgtgggaacggcatccagctccgccacgac
ttctgcatcaagccgcccaccctccggccggtgcccgcgttcttctgccagcacgtcccc
aaggccccgacagtgaggaggtgttcccccggaccctgcccccgggagacggggcccagc
ctggcgccgcgcggagcggccgccgccccagcccccgtggagacggccgccgccgggtcc
cccgaggacccccgggacccggccccggatcttctccgccctcctctcccctcggccccc
gggcctctggagcccccgggacggagggacctcgaggagtccagggcctgtgggaagcac
cacctcggcgccacagggaccatcaacatgacggggacgcgggcgacggccgactgcacg
gtggccatcggccgccccctgggtgaggtggtggtcctccacgtcctggagagttccctc
aactgcagcgccggggacatgctgctgatcgccgggcggctctcgtggaggaaagcctgc
cggcagctgaccgggatgatcgtcggctccaggaccaacacgctgatggtgaggcagagg
cgcgtactggccgggagcggggtcgtgctgcggtactggagccaagcggcgacggacgga
taccaccgagagtgtgacgtgcagctgttcggccccaagggggaaattaccagtcccccg
ctgcgcccgggcctggaaaaccgagggagatgtcggatcttcatcgatgtggcccctcag
gcccggatagccatccacgctctggccataaacctgccggcgggggccagtcggactcgg
gccagctacatttcgatccgcgacacgccgctcatgaagacgacgacgttctacgggcag
cagctcttctactgggaatcggtgggcagccaggcggagatcgaattcggcgagagcttc
cgagacgaccacaccggcttccggggccaatactggacccttaaatccagatga

DBGET integrated database retrieval system