KEGG   Ornithorhynchus anatinus (platypus): 100077359Help
Entry
100077359         CDS       T01045                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00350  Tyrosine metabolism
oaa01100  Metabolic pathways
Module
oaa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100077359 (GSTZ1)
Enzymes [BR:oaa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100077359 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Tom37 GST_C_5
Motif
Other DBs
NCBI-GeneID: 100077359
NCBI-ProteinID: XP_001505837
Position
1
AA seq 237 aa AA seqDB search
MREGTESGEVPEQSKDHTSTMAEPGKPILYSYFRSSCSWRVRIALALKGITYETIPVNLI
KDGGQQFTGEFQAMNPMQQVPALKIDGITISQSLAIIEYLEETRPSPSILPRDPKKRASV
RMISNVIAAGIQPLQNLSVLKQVEQEKQLAWAQQCICQGFKALEQILQGTAGKYCMGDEV
SMADLCLVPQVANAERFKVNLAPYPTIKRINEALLNLEAFQVTHPCRQPDTPPELRA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaggcacagagtcaggggaagtgcctgagcagagcaaggatcacactagcacc
atggcagagcccggcaagcctatcctgtactcttatttccgaagctcctgctcctggagg
gtccgcatagctcttgccctgaaagggatcacctatgagaccatcccagttaacctcatc
aaggacggggggcagcagttcacgggcgaattccaggcaatgaaccccatgcagcaggtc
ccagccctcaagatcgatggcatcaccatttcccaatcactggccatcatcgagtacctg
gaggagacgcggcccagcccgagcatcctgccccgggatcccaagaaaagagccagcgtc
cgcatgatctccaacgtgattgccgccggcatccagcccctgcagaacctgtctgtcctg
aagcaagtggaacaggagaaacagctggcctgggcacagcagtgcatctgccagggtttc
aaagctctggagcagatcctgcagggcacggccgggaagtactgcatgggagatgaggtc
tccatggcggacctctgcctggtgcctcaggtagccaatgctgagaggtttaaggtgaac
cttgccccctaccccaccatcaagcgcatcaacgaggcgctgctgaaccttgaggccttt
caagtgacccacccctgccggcagcccgacacgcctccagagctgcgagcctga

DBGET integrated database retrieval system