KEGG   Ornithorhynchus anatinus (platypus): 100077528Help
Entry
100077528         CDS       T01045                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X13
  KO
K09052  cAMP response element modulator
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100077528 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oaa03000]
    100077528 (CREM)
Transcription factors [BR:oaa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100077528 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5 Phage_Gp23 DUF4988
Motif
Other DBs
NCBI-GeneID: 100077528
NCBI-ProteinID: XP_001508739
Position
13
AA seq 113 aa AA seqDB search
MQKPNMAVTGDETAATGDMPTYQIRTPSTALPQGVVMAASPGSLHSPQQLAEEATRKREL
RLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagccgaacatggctgtaacaggagatgaaacagccgccactggtgacatgcca
acctaccagatccgaactccctctaccgctttgccacagggagttgtgatggcagcctcc
ccaggaagtctgcacagtccacagcagctggcagaagaagccacccgcaagcgagaactg
agacttatgaaaaatagggaagctgctcgggaatgtcgcaggaagaagaaggagtatgtc
aaatgtcttgaaaatcgtgtggctgtacttgaaaaccaaaacaagactctcattgaggaa
ctcaaggccctaaaagatctttattgccacaaagcagagtaa

DBGET integrated database retrieval system