KEGG   Ornithorhynchus anatinus (platypus): 100077776
Entry
100077776         CDS       T01045                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100077776 (RDH5)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100077776 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 100077776
NCBI-ProteinID: XP_028928509
Position
10
AA seq 322 aa
MWLWGLGVLGLALLWAGLWAIRDRWPRAGGTDGFIFITGCDSGFGRLLALRLQRRGWSVL
AACLTPTGADALQREASPGLRTTLLDVTDPNSVQRAAQWVDSLVGQRGLYGLVNNAGVSG
PMGPNEWQRVEDFRRVLEVNTLGAVGVTLALLPLLRRARGRLVNVTSVLGRLAANGGGYC
LSKFALEAFSDSLRRDLYHFGVRVSIVEPGFFRTAVTSLPSLEGALRERWDRLPPETRAS
YGPDFFPQYLRVQRRLMTQLCSGDLNKVTNCLEHALTARHPRTRYSPGWDAKLLWLPASY
LPACVVDAILARILPRPAAHTP
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtggctgtggggcctgggggtgctgggcttggccctgctctgggccggactctgggca
atccgggaccgctggccacgggcgggtggcaccgacggcttcatcttcatcacgggctgc
gactcggggttcgggcgtttgctggccctgcgactgcagcggcggggctggagcgtgctg
gccgcctgcctcacccccacgggggccgacgcgctgcagcgggaggcatcccccggcctc
cgcaccaccctgctcgacgtcaccgacccaaacagcgtgcagagggcggcccagtgggtg
gattcgctggtagggcagagagggctgtacgggctggtgaacaatgcgggggtgtcgggc
cccatgggacccaacgagtggcagcgggtggaagatttccgcagagtcctagaggtgaac
acgctgggcgccgtcggcgtgactctggccctactgcccctgctccgacgggccaggggc
cgcctcgtcaacgtcaccagcgtcctgggccggctggcggccaacggcggcgggtactgc
ctttccaaattcgccctggaggccttctcggacagcctgcggcgggacctctaccatttc
ggcgtccgagtctccatcgtggagcccggcttcttccgcacggcggtgaccagcctgccc
agcttggagggggcgttgcgggagcggtgggaccggctgccccccgagacccgcgccagc
tacggccctgacttcttcccccagtatctgcgggtgcagcgacgcctcatgacacagctg
tgctccggggacctgaataaggtgacaaattgcctggagcacgccctgacggcccgccac
ccccgcacccgctacagccccggctgggacgccaagctgctctggctgccggcctcctac
ctgcccgcctgcgtagtggatgcaatattggcccggatcctgccccggcccgccgcccac
accccttag

DBGET integrated database retrieval system