KEGG   Ornithorhynchus anatinus (platypus): 100077965Help
Entry
100077965         CDS       T01045                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00230  Purine metabolism
oaa01100  Metabolic pathways
oaa04022  cGMP-PKG signaling pathway
oaa04270  Vascular smooth muscle contraction
oaa04540  Gap junction
oaa04611  Platelet activation
oaa04713  Circadian entrainment
oaa04730  Long-term depression
oaa04921  Oxytocin signaling pathway
oaa04924  Renin secretion
oaa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100077965 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100077965 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100077965 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100077965 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100077965 (GUCY1A2)
   04924 Renin secretion
    100077965 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100077965 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    100077965 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    100077965 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100077965 (GUCY1A2)
Enzymes [BR:oaa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100077965 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 100077965
NCBI-ProteinID: XP_028904117
Position
20
AA seq 715 aa AA seqDB search
MARRKISSDSLSSVGSEAEAAPCPGPGPDPGDCPLARLCWNGRRSPGAPPCAPPSAAGPA
RRGPRRTRVNLDSLGETIGRLTAPTPQTIQQTLKRTLQYYEHQVIGYRDAEKNFHNISNR
CSYADRSNKDEVEDVSGILQGTANILGLKFEDMQEKFGEEFFNICFDENERVLRAVGGTL
QDFFNGFDALLEHIRTSFGRQVTLESPSFLCKELPGGPLMLHYFHPHHVVGFAMLGMIKA
AGKKIYRLDVEVEQVTPDPPGSEGSNPGNCSCLSFLIKERVDANSPQTFPPGTSLVPADL
RINISTFCRAFPFHLMFDASMWVLQLGEGLRKQLRCETHKALNFEDCFEIVSPKIGATFE
RVLSRLSTPFVIRTRAEASGSEDRDKVMEVKGQMIHVPESSCILFLGSPCVDKLDELMGR
GLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHRALEEEKKKTVDLLIS
IFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQ
CGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIG
IHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIP
RSREELPDNFPKEIPGICYFLEVTTGPKQPKSASSTRVKKVSYNIGTMFLRETSL
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaggaagatctcgtccgactcgttgagctccgtggggtccgaggccgaggcc
gccccctgccccggccccgggcccgaccccggggactgccccctggcccgcctctgctgg
aacggccgccgcagccccggcgcgccaccctgcgctccaccctccgccgccggcccggcc
cggaggggcccccgccggaccagggtcaacctcgactccctgggagagaccatcggccgc
ctgacggcccccacgcctcagacaatacagcagactctcaagaggacactccaatattat
gagcatcaagttattggttacagggatgcggagaagaattttcacaatatctctaacaga
tgctcctatgcagaccgttccaacaaagatgaagttgaagatgtctcaggaattcttcag
ggcacagcgaatatactgggtttgaagtttgaggacatgcaagaaaaatttggggaggaa
ttctttaatatctgcttcgatgagaacgaaagagttctccgagccgtaggtggaaccctg
caggacttttttaacgggttcgacgctctgctggaacacattcgaacttcattcggaaga
caggtcactctggaatccccgtctttcctatgcaaagagctcccgggaggccccctcatg
ctccactactttcacccgcaccacgtcgtagggtttgcgatgctggggatgataaaggcc
gccggtaagaagatctaccgcctggatgtggaagtggagcaggtcactccggatccgccg
ggctcggaggggtcaaacccgggaaactgcagctgcctgtccttcctcatcaaagagcgt
gtcgatgcaaacagcccgcagaccttccccccgggaacgtcgctggtgccggccgacctc
cgcatcaacatcagcaccttctgcagggccttccctttccacctgatgtttgacgcgagc
atgtgggtgctgcagctgggggaggggctgaggaagcagctccgctgcgagacgcacaag
gcgctgaacttcgaggactgcttcgagatcgtctccccgaagatcggcgccactttcgag
cgcgtcctgtccagactgtccaccccctttgtcatccgaaccagggcggaggcttccggc
tccgaggacagagacaaggtgatggaagtcaaaggccaaatgatccacgtcccggagtcc
agttgcattttatttttgggctccccgtgcgtggacaagctggacgaactgatgggccgc
ggcctccatctctccgacatccccatccacgacgcgacccgcgatgtcatcctggtggga
gagcaggccaaggcccaggacggactgaagaagcggatggataagttgaaggccacgtta
gaacgaactcaccgggctctggaggaggaaaaaaagaagacggtggatcttctgatttcc
attttcccgggcgatgtagctcagcagctgtggcaggggcagcaagttcaagccaggaag
ttcgacgacgtcaccatgctcttctcggacattgtgggcttcacggcgatctgcgcccag
tgtacgcccatgcaggtcatcagtatgctgaatgaactctacactcgatttgaccaccag
tgtggatttctggatatctataaggtggagacgataggggatgcgtattgcgtggcagca
ggactccacaggaagagcctttgtcatgccaagcccattgccctgatggcactgaagatg
atggagctgtcagaggaggtgctgacgcccgacggaagacccattcagatgagaataggg
attcactcaggctctgtgttggcgggggttgtcggggtaagaatgccacgatactgtctg
tttggaaacaacgtcacccttgcgagtaaatttgagtcgggaagtcaccctcgccgcatc
aacgtcagtccgaccacgtaccagcttttgaaaagggaagaaagtttcacgttcattccc
cggtcccgcgaagagcttccagacaactttccaaaggaaatccctgggatctgttacttc
ctggaggtcacaaccgggcccaaacagccaaagtctgcttcttcaacgcgagtgaaaaag
gtttcctacaacattggaaccatgttccttcgagagacaagcctttga

DBGET integrated database retrieval system