KEGG   Ornithorhynchus anatinus (platypus): 100078009Help
Entry
100078009         CDS       T01045                                 

Gene name
MTMR4
Definition
(RefSeq) LOW QUALITY PROTEIN: myotubularin-related protein 4
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00562  Inositol phosphate metabolism
oaa01100  Metabolic pathways
oaa04070  Phosphatidylinositol signaling system
oaa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100078009 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100078009 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100078009 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oaa01009]
    100078009 (MTMR4)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100078009 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100078009 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100078009 (MTMR4)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100078009 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE
Motif
Other DBs
NCBI-GeneID: 100078009
NCBI-ProteinID: XP_028938345
Position
17
AA seq 1138 aa AA seqDB search
MSRDRQEKQVPGTQGPHPSRMGEEGPPSLEYIQAKDLFPPKELVKEEESLQVPFAVLQGE
GVEFLGRAADALIAISNYRLHVKFKDSVINVPLRMIDSVESRDMFQLHISCKDSKVVRCH
FSTFKQCQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEPVRCRQE
AELARMGFDLHNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVV
YRHLRNGAAIARCSQPEISWWGWRNADDEYLVTSIAKACALDPGGKVAGGSACGGNGEGS
EAGDTDFDSSLTACSGVESSSGPQKLLILDARSYTAAVANRAKGGGCECEVLPNCEVVFM
GMANIHSIRNSFQYLRAVCSQMPDPSNWLSALESTKWLQHLSVMLKAAVLVSNAVDGEGR
PVLVHCSDGWDRXPQIVALAKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAE
DQNEQCPVFLQWLDSVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREMR
NIYKRTCSVWALLRAGNKNFHNFLYVPGSELVLHPVCHVRALHLWTAVYLPPSSPCTLRE
ESVDLYLAPAAQSQEFSGRSLDRLPKTXSVDDLLSACDTSSPLTRTVSDPXPXINHCQEA
RVTWSPGPASQTGADPPRGTHGPVGPAATTLELGHLLRRPPGHGFLGPGRDREPPLRLLV
GAGPGCLWGKLREPWRRARRLRIPGRMAVWATRRVACPAPGDPAAAPAPPRDPRALPGRG
TSRRALRMPGRTPGPRRKTFGGEKMSGTGRRRKALALGKAPPELGPQAGFQSQMSEFSFL
GSNWESFQGWWLRSERGRRHPRRLLSYGCCGKRSGSKPTRTTGPCPAGQWAQREGVKSPI
CSSQSGGHCAGPLREKQTRTWPAGIAPSRRPAPKPAAGQLPITPGPPLYLDDEGCPFPPD
GDPGRGLRQIEAGYKPGGGDFLRRQCRELQMRLDIPPPCMKAEVAPRRSPPWTYEDDSTC
LKESDASDAEDFGSDPSEDGLSEASWEPVDKKRNXDQPWRPHCYNCDCEFWLAKRRHHCR
NCGNVFCAGCCHLKLPIPDQQLYDPVLVCNACYEHIQVSRARELMNQHLKKPIATASS
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgagaccggcaggagaagcaagtccccgggacccagggcccccaccccagtagg
atgggtgaagaggggcctcccagcctggagtacatccaagccaaggacctgttccccccc
aaggagctggtgaaggaggaggagagtctgcaggtaccgtttgcggtgctgcagggcgag
ggggtggagttcctgggccgagcggccgatgccctcatcgccatctccaactaccgcctg
cacgtcaagttcaaggactcggttattaacgtgcccctgcggatgattgacagcgtggag
agccgggacatgttccagctgcacatctcctgcaaggactccaaggtggtgaggtgccac
ttctccactttcaagcagtgccaggagtggctgtcgcgactgagccgggccacggcccgg
cccgccaagcccgaggacctgtttgcttttgcctaccatgcctggtgcctgggcctcacc
gaagaggaccaacacactcatctgtgccagccaggggagccagtgcggtgccggcaggag
gcggagctggcgcgcatgggttttgatctacacaacgtctggagggtctcccacataaac
agcaactacaagctctgccccagctacccccagaagctcctggtccccgtgtggatcacc
gacaaggagctggagaacgtggcctccttccgctcctggaagaggattcccgtggttgtg
tacagacatctccggaacggagccgccatcgcccgctgcagccagcccgagatcagctgg
tggggctggcgcaatgccgacgacgagtacctggtcacgtccatcgccaaagcctgcgct
ctggacccagggggcaaggtggccggaggctccgcctgcggtgggaacggcgaggggagc
gaagccggcgacaccgacttcgactcctccctgacagcctgctcgggggtggagagcagc
agtgggccccagaagctcctgatcctggacgcccgctcctacactgccgccgtggccaac
cgggccaaaggtggaggctgtgagtgtgaagtactacccaactgcgaggtggtgttcatg
ggcatggccaacatccactccatccgcaacagtttccagtacctgcgggcagtctgcagc
cagatgccggatcccagcaactggctgtcggccctggagagcaccaagtggctgcagcac
ctgtcggtcatgctgaaggcggccgtgttggtgtccaacgcggtggacggggagggccgc
ccagtgttggtccactgttcggacggctgggaccgcnacccccagatagtggcgctggcc
aagatcctgctggacccctattacaggaccctggagggcttccaggtgctggtggagtcc
gactggctggattttggccacaagttcggggaccgctgcggccaccaggagaacgcggag
gaccagaacgagcagtgcccggtgttcctgcagtggctggactcggtgcatcagctgctg
aagcagttcccctgcctgtttgagttcaacgaagcgttcctggtgaagctggtgcagcac
acgtactcctgcctgtacggcaccttcctggccaacaacccgtgcgagcgagagatgcgc
aacatctacaagcggacctgctccgtgtgggccctcctacgagccggcaataagaacttc
cacaacttcctctacgtgcccggctccgagctggtcctgcaccccgtgtgtcacgtgcgg
gccctccacctctggacggcagtgtacctcccgccgtcgtccccgtgcaccctcagggag
gagagcgtggacctctaccttgccccggccgcccagagccaggagttcagcggccggtcc
ctagacagactgcccaaaacgnaatccgtggatgacctcctttcggcctgtgacaccagt
agtccgctaactcgcaccgtcagcgacccgtaaccgtgaataaaccattgtcaggaggcc
agagtgacctggagccccggtccagccagccagacaggagcggaccccccgcgggggaca
cacggccccgtcggccccgccgcgaccacgctggagctgggccaccttctccgccgcccg
cctggacacggcttcctcgggccgggccgggatcgggaacctcccctgagactcctggtc
ggagccggccccggatgcctctggggaaagctccgcgagccctggcgccgggccagaagg
ctccggatcccgggccggatggccgtctgggccactcggagggtcgcctgccccgctccg
ggagaccccgcggcggcacctgccccaccccgagaccctcgggccctgcctggtcggggc
acctctcgcagggccctccgaatgccgggccggaccccgggccccaggaggaagacgttc
ggaggcgagaaaatgtcaggaacgggccgccgacggaaagcgctcgctttggggaaagcg
ccgccggaactggggccgcaagccggtttccagagccagatgagcgagttttctttcctg
ggatccaactgggagagtttccagggatggtggcttcgctccgagcgggggaggcggcac
ccccgccgcctgctttcttatggctgctgcggcaagaggtccggcagcaagccgacgcga
acgacggggccttgccccgctggccagtgggcccagagagaaggagttaagtcgcccatc
tgctctagtcagtccggtggacactgtgccggcccgctgcgggaaaagcaaacgaggacg
tggccagctgggatcgccccaagccggcgtccggccccaaagccggctgccggccagctg
cccattactcccgggcctcccctgtacctggatgacgagggctgcccgttccccccggat
ggtgatccaggcagagggttacggcagatcgaggcgggctacaagccaggaggtggagac
ttcctccgccgccaatgccgggagctccagatgaggctggacataccgccaccttgcatg
aaggccgaggtggcgccccggcggagccctccgtggacttacgaggacgactcgacgtgt
ctgaaggagtcggatgcgagcgacgccgaggattttggctccgatcccagcgaggacggc
ctttcagaagcaagctgggagcccgttgataagaagagaaactgagaccagccatggcgt
ccccactgctacaactgcgactgtgagttctggctggccaaacggagacaccactgcaga
aattgtgggaacgtgttctgcgccggctgctgccacctgaagctgcccattcccgaccaa
cagctctacgaccctgtcctcgtttgtaacgcctgctacgaacacatccaggtgtctcgc
gccagggagctgatgaaccaacatctgaagaagccaatcgccacagcttccagctga

DBGET integrated database retrieval system