KEGG   Ornithorhynchus anatinus (platypus): 100078100Help
Entry
100078100         CDS       T01045                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04060  Cytokine-cytokine receptor interaction
oaa04080  Neuroactive ligand-receptor interaction
oaa04151  PI3K-Akt signaling pathway
oaa04630  Jak-STAT signaling pathway
oaa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100078100 (PRLR)
   04151 PI3K-Akt signaling pathway
    100078100 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100078100 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100078100 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    100078100 (PRLR)
Cytokine receptors [BR:oaa04050]
 Interleukin receptor families
  Prolactin receptor family
   100078100 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind IL6Ra-bind GHBP
Motif
Other DBs
NCBI-GeneID: 100078100
NCBI-ProteinID: XP_007658329
Position
3
AA seq 591 aa AA seqDB search
MKKNVASTIAFIFLLFLNMELLTGLSPPGKPQVDMCRTPNKETFTCWWKPGSDGGLPTNY
TLFYNKEGSEVIYECPDYKTGGPNSCYFNKAHTTMWKVYSIFVNATNQMGSNISDTYYAD
VAYILKPDPPVNLTLELKHTKDGKPYLWVKWSPPNLADVRIGWVTLLYELQLKPEKGVEW
EVVDSHGFWSQWSLPSSIWVPDDFQVKDMTVWIFVAVLSSVVCLIMIWTMALKGYSMIAC
LLPPVPGPKIKGFDTHLLEKGKSEELLSALGCQGFPQTSDYEDLLVEFLEVDDSEDQQLM
PAPEKGHSQPSVKPAHLETDNDSGRGSCDSPSLLSEKCEEPQPPPPTFQPPPDHDDEKPS
KPAPKSCRNWGSQSLDLEGKTPYFHAMGSKSSTWPMPQQASHHTPRASYHNLSNVFKMAP
EALFTGQGETHPSKYSKPLETVGDDKKGERNEPGQDPTWLLPSEKSLFGSAKPMDYVEIH
KVNKDGALALLPKRKEDPGQAETFTVPEASKEYAKVSRVMDDNILVLMHDTRGLTAPEFE
ESAKEASPPLRQNQAEKKMAYTATVTTPNDCRLQMGGLDYMDPTCFMHSFN
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatgtggcatcgacaattgcttttatttttctgcttttccttaacatggaa
cttctgacggggctgtcaccgcctggcaagcctcaggtagatatgtgtcgaactccaaac
aaggaaacattcacttgctggtggaagccaggatcggatggaggacttcctaccaactac
actctgttctacaataaagaaggaagcgaagtcatctatgaatgcccagactacaaaacc
ggaggccccaactcctgttacttcaataaggcccacaccaccatgtggaaagtttacagc
attttcgtcaatgcaacaaaccagatgggaagtaatatctctgacacgtattacgcggat
gtggcatacatacttaaaccagaccctcctgtgaacctgaccctggaacttaaacatacg
aaagacgggaaaccatatctttgggtgaagtggtccccacccaacctggccgatgtcagg
atcggttgggtcacccttttatatgaactgcaactcaaaccggagaaaggggttgaatgg
gaggtggtggattcccatggattctggagtcagtggagcctgccaagttccatctgggtg
ccggatgacttccaagtgaaagatatgacagtgtggatttttgtggctgttttatcatct
gtcgtttgcttgatcatgatctggacaatggctctcaaaggctacagcatgatagcttgc
ctcttgccacctgtccccgggccaaagataaaaggatttgacacacatctgctagagaag
gggaaatctgaagagctcctgagtgctctggggtgccaaggcttcccccagacatcagat
tatgaggacctcctggtagagtttttggaagtagatgacagtgaggaccagcagctgatg
ccggctcccgaaaagggtcactcgcaacctagcgtgaagccggcccacctggaaacagac
aacgactcgggccgagggagctgtgacagtccttccctcttgtccgagaagtgcgaggag
ccccagcccccgccacccaccttccagccaccccccgaccatgatgacgagaagcccagc
aagcccgctccgaaaagctgcagaaactgggggtcccagagcctagacttggaagggaaa
accccctactttcacgccatggggtccaaatcctccacgtggcccatgccccagcaggcc
agccaccacaccccaagagcctcctatcacaatctgagcaatgtttttaaaatggccccg
gaggcccttttcacgggacaaggagagacgcatccctcaaaatactcgaaacccttggag
actgtcggcgatgacaaaaaaggcgaacggaacgagcccggccaggaccccacttggttg
ctgcctagcgagaagtcgctcttcggctctgctaaaccgatggattatgtggagattcac
aaagtcaacaaagatggtgccctggcactgctccccaaacggaaagaggatccaggccag
gcagagacgttcactgttccggaagccagcaaggaatacgcgaaggtgtccagagtcatg
gatgacaacatcctggtgttgatgcatgataccagaggtctgaccgctcctgagtttgaa
gaatctgctaaggaagcctctccgcccctacgccagaatcaagccgagaagaaaatggcc
tacacagccaccgtcacaactccaaacgactgcagactacagatgggtgggttggattac
atggatcccacttgttttatgcactcctttaattga

DBGET integrated database retrieval system