KEGG   Ornithorhynchus anatinus (platypus): 100078336Help
Entry
100078336         CDS       T01045                                 

Gene name
RARS
Definition
(RefSeq) arginine--tRNA ligase, cytoplasmic isoform X1
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100078336 (RARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oaa01007]
    100078336 (RARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oaa03016]
    100078336 (RARS)
   03029 Mitochondrial biogenesis [BR:oaa03029]
    100078336 (RARS)
Enzymes [BR:oaa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     100078336 (RARS)
Amino acid related enzymes [BR:oaa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   100078336 (RARS)
Transfer RNA biogenesis [BR:oaa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100078336 (RARS)
 Prokaryotic type
   Other AARSs
    100078336 (RARS)
Mitochondrial biogenesis [BR:oaa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100078336 (RARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e Cnn_1N tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 100078336
NCBI-ProteinID: XP_001509403
Ensembl: ENSOANG00000007814
Position
X1
AA seq 691 aa AA seqDB search
MTSLSMEPRALILTLGTLKEEKFQTILGQKKTELNQALPVPANCQEKEIKFLTAEIDRLK
NFGSLGVSPGVEQLRDENTKLKYRLNVLRKSLQEERNKPTKSMININSRLQEIFGYAIKA
AYPDLENPPLAVTPSQQSKFGDYQCNSAMSITQMLQKTKEQKVSPREIAEKITKNLPDND
YIDKVEIAGPGFINVHLSKSFVSKQLTNLLVNGVQPPALGEIKKVVVDFSSPNIAKEMHV
GHLRSTIIGDSMCRLFEFVGYDVLRLNHLGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDL
QAFYKESKKRFDTEEEFKKRAYQCVVLLQSKTPEITKAWKMICDVSRQEFNKIYDALDIS
IIERGESFYQDRMNDVVKEFEDRGFVEVDDGRKIVFVPGCPVPLTIVKSDGGYTYDTSDL
AAIKQRLFEEKANIIIYVVDSGQSVHLQTVFAAAKMIGWYDPQETRVVHAGFGVVLGEDK
KKFKTRSGDTVRLIDLLEEGLKRSMDKLKEKERDKVLTPEELRTAQTSVAFGCIKYADLS
HNRMNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLRKAAQETEILLDHE
KEWKLGRCILRFPEILQKILDDLFLHTLCDYIYELATTFTEFYDSCYCVEKDRQTGKIVK
VNMWRMLLCEATAAIMAKGFDILGIKPVQRM
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgacttctctctccatggagccccgtgctttgattctgactctgggcaccctgaaggag
gaaaagttccaaacgattctgggacaaaagaaaaccgaactcaaccaggctttaccggtt
cctgcaaactgccaggagaaagagattaaatttctgaccgccgaaatcgatcgattgaaa
aactttgggtctttaggagtttctccaggtgtggagcagctgcgagacgaaaacacaaag
cttaagtatcgactgaacgtgctccgaaagagtcttcaagaagaaaggaataaacccacc
aaaagcatgatcaacatcaatagccgcttacaagaaatctttggttatgctatcaaggcc
gcatatccagatttggaaaaccctcccttggcagtcacaccaagccagcagtccaagttt
ggagattatcaatgtaatagtgctatgagcatcacacagatgctgcagaaaacgaaggaa
cagaaagtaagcccaagggaaattgcagaaaagattaccaaaaatcttccagacaatgat
tacatcgacaaagttgagattgctggtcctggttttattaacgtccacctaagcaagagt
tttgtatcaaaacaactcactaatctgttggtgaatggagttcagccacctgctctgggg
gagataaaaaaggttgtagttgacttttcttctccaaacatcgccaaagagatgcacgtt
ggccacctgaggtcaacaatcatcggagacagtatgtgccggctctttgagtttgtgggt
tatgatgtcctgaggttaaatcatctaggagactgggggacccagtttggcatgctcatt
gctcaccttcaagataaatttccagactacctgactgtttcacctcccataggtgacctc
caggccttttataaggaatccaagaagcggtttgacacagaggaagaattcaaaaaacgg
gcctaccagtgtgtggttctactgcagagtaaaacaccagagatcaccaaagcttggaag
atgatctgtgatgtctctcgccaagagttcaacaaaatctatgacgctttggacatttcg
ataatagagaggggagaatctttctatcaagataggatgaatgatgttgtgaaggaattt
gaagacagagggtttgtggaggtggatgatggacggaagatcgtgtttgttcccgggtgt
ccggtccccttaacgatagtaaaatcagatgggggttatacttatgacacctctgacttg
gctgctattaagcaacggctatttgaggaaaaggcaaatataatcatatacgtggtcgac
agtggccagtccgtgcacttgcagacggtgtttgcagcagctaagatgatcggttggtat
gatccccaggaaaccagagtagtacacgctgggtttggagtcgtgctgggagaagacaag
aagaagtttaaaacccgctcaggtgacacagtgcgtctcatagacctcctagaggaagga
ctgaaacgatccatggataaactaaaggaaaaagagagagataaggtcttaaccccagag
gaactcagaactgcccagacatcagtcgcttttggctgcatcaaatatgctgatctttct
cacaaccggatgaacgactacatcttctccttcgacaaaatgctcgatgacagaggaaac
acagctgcttatttgctctatgccttcactagaatcagatccatagcccgtctggctaat
attgacgaagagatgttgcggaaagctgcccaagaaacggagatccttttggatcatgaa
aaggaatggaaactgggtcggtgcattttaaggtttccagagatcctgcagaaaattctg
gatgacttgtttctccacaccctctgtgattatatctatgagctggcgaccaccttcaca
gaattttacgatagctgttactgcgtggagaaagaccgacagactggtaaaattgtgaag
gtgaatatgtggaggatgttgttgtgtgaagcaactgctgccatcatggccaaaggattt
gatatcctgggaatcaagcctgtccagaggatgtaa

DBGET integrated database retrieval system