KEGG   Ornithorhynchus anatinus (platypus): 100079784Help
Entry
100079784         CDS       T01045                                 

Gene name
CYP1B1
Definition
(RefSeq) cytochrome P450 1B1
  KO
K07410  cytochrome P450 family 1 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00140  Steroid hormone biosynthesis
oaa00380  Tryptophan metabolism
oaa00980  Metabolism of xenobiotics by cytochrome P450
oaa04913  Ovarian steroidogenesis
oaa05204  Chemical carcinogenesis
oaa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100079784 (CYP1B1)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    100079784 (CYP1B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100079784 (CYP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100079784 (CYP1B1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100079784 (CYP1B1)
   05204 Chemical carcinogenesis
    100079784 (CYP1B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:oaa00199]
    100079784 (CYP1B1)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100079784 (CYP1B1)
Cytochrome P450 [BR:oaa00199]
 Cytochrome P450, animal type
  CYP1 family
   100079784 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100079784
NCBI-ProteinID: XP_028918085
Ensembl: ENSOANG00000004755
Position
1
AA seq 535 aa AA seqDB search
MTASVEGEAGRPDPTAAAAAAQLVSPAQLVTLALLLTLLAAWVRRGSGRVRRDGLRTPPG
PFPWPLVGNLVQLGSAPHLALGALAGRYGSVFRLRLGARPAVVLSGQRAIRQALLRQAGD
FSGRPAFPSFGEVSGGRSLAFGPYSAGWRARRKLAQGAVRALSGRAGLERPVLGEARELV
RRLARGCAGGASLDPAPPAGLAVANVMRALCFGGRSSPDGPPDVPCEDFGRTVGAGGLVD
ALPWLRRFPNPARSAFRDFQRFNRRFYGFVLRRCRRRRRRPAPPPGRPPRHMLDALLGAA
RAQRPPLPFDQVPPTLTDIFGASQDTLSTALHWLLLLFVRFPKVQAEVQEELDRVVGRER
LPCMADQPTLPYLMAFLYEAMRFSSFVPLTIPHATTSDTSILGFHIPKDTVVLINQWSVN
HDPVTWRNPEDFCPARFLDKNGFVDKDLASSVMIFSLGKRRCIGEELSKLQLFLFTAILA
HQCNFIADPDEIAKVKFSYGLTIKPKPFKINVTLRESMELLDKAVQRLQEEEDSQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgtccgtggagggtgaggcggggcggccggacccgacggcggcggcggcggcg
gcgcagctggtgagcccggcgcagctggtgaccctggcgctgctgctgaccctgctggcg
gcctgggtccggcgcggatcggggcgcgttcgccgggacgggctccggacccctccgggc
cccttcccgtggcccctggtgggcaacctggtgcagctgggcagcgccccgcacctggcc
ctgggcgcgctggccgggcgctacggctcggtgttccggctgcgcctgggggcccggccg
gcggtggtgctcagcgggcagcgcgccatccgccaggccctgctgcgccaggccggggac
ttctccggccggccggccttcccgtcgttcggcgaggtgtccggcggccgcagcctggcc
ttcgggccctactcggccggctggagggcgcggcgcaagctggcccagggcgcggtgcgg
gccttgtccggccgggcgggcctggagcggccggtgctgggcgaggcgcgggagctggtg
cgccggctggcccggggctgcgcggggggcgcctcgctggacccggcccctccggccggc
ctggccgtggccaacgtcatgcgcgccctctgcttcggcggacgctcctcccccgacggt
ccccccgacgtcccctgcgaggacttcggccgcacggtgggcgccggggggctggtggac
gcgctgccctggctgcgccgcttccccaaccccgcacgctcggccttccgagacttccag
cgcttcaaccgacgcttctacggcttcgtcctccgccggtgccggcgccgccgccgccgg
cccgccccgccgcccggccgcccgccccggcacatgctcgacgccctcctcggcgccgcc
cgcgcccaacggcccccgctgcccttcgaccaagtgccccccaccctcaccgacatcttc
ggcgccagccaggacaccctctccacagccctccactggctgctcctcctcttcgtcagg
ttccccaaagtgcaagctgaagtgcaagaagaactggacagagtcgtgggcagggagcgc
ctgccgtgtatggccgatcagccaacgttgccctaccttatggccttcctatacgaggcc
atgcgcttcagcagtttcgtgcctctcaccatccctcacgccaccacatccgacacctcg
atcctggggttccacattcccaaggacacggtggtgctcatcaaccagtggtcggtgaat
cacgacccggtgacatggcgtaacccggaggatttctgtccagccaggtttctggacaag
aatgggttcgtggacaaggatctggccagcagcgtgatgatcttctcgctgggcaaacgg
cggtgcatcggagaagagctctccaagctacagctgtttctcttcactgccatcctcgcc
caccagtgcaatttcatcgccgatccggacgagatcgccaaagtgaagttcagctacggg
ttgactatcaaacccaagccatttaaaatcaatgttacccttagagagtcgatggagctt
ctggataaggctgtccaaagactgcaagaggaagaagacagccagtga

DBGET integrated database retrieval system