KEGG   Ornithorhynchus anatinus (platypus): 100080176Help
Entry
100080176         CDS       T01045                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04060  Cytokine-cytokine receptor interaction
oaa04068  FoxO signaling pathway
oaa04110  Cell cycle
oaa04218  Cellular senescence
oaa04350  TGF-beta signaling pathway
oaa04380  Osteoclast differentiation
oaa04390  Hippo signaling pathway
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa05140  Leishmaniasis
oaa05142  Chagas disease (American trypanosomiasis)
oaa05144  Malaria
oaa05145  Toxoplasmosis
oaa05146  Amoebiasis
oaa05152  Tuberculosis
oaa05161  Hepatitis B
oaa05166  Human T-cell leukemia virus 1 infection
oaa05200  Pathways in cancer
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05212  Pancreatic cancer
oaa05220  Chronic myeloid leukemia
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05321  Inflammatory bowel disease (IBD)
oaa05323  Rheumatoid arthritis
oaa05410  Hypertrophic cardiomyopathy (HCM)
oaa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100080176 (TGFB2)
   04350 TGF-beta signaling pathway
    100080176 (TGFB2)
   04390 Hippo signaling pathway
    100080176 (TGFB2)
   04068 FoxO signaling pathway
    100080176 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100080176 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100080176 (TGFB2)
   04218 Cellular senescence
    100080176 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100080176 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100080176 (TGFB2)
   05206 MicroRNAs in cancer
    100080176 (TGFB2)
   05205 Proteoglycans in cancer
    100080176 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100080176 (TGFB2)
   05212 Pancreatic cancer
    100080176 (TGFB2)
   05225 Hepatocellular carcinoma
    100080176 (TGFB2)
   05226 Gastric cancer
    100080176 (TGFB2)
   05220 Chronic myeloid leukemia
    100080176 (TGFB2)
   05211 Renal cell carcinoma
    100080176 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100080176 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    100080176 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100080176 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    100080176 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100080176 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100080176 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100080176 (TGFB2)
   05161 Hepatitis B
    100080176 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100080176 (TGFB2)
   05144 Malaria
    100080176 (TGFB2)
   05145 Toxoplasmosis
    100080176 (TGFB2)
   05140 Leishmaniasis
    100080176 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    100080176 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oaa04052]
    100080176 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:oaa00536]
    100080176 (TGFB2)
Cytokines and growth factors [BR:oaa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100080176 (TGFB2)
Glycosaminoglycan binding proteins [BR:oaa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100080176 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 100080176
NCBI-ProteinID: XP_028903004
Position
19
AA seq 452 aa AA seqDB search
MRCSLLSVVLTLDLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVVSIYNSTRDLLQEKANQRAAACERERSDEEYYAKEVYKIDMLPYFPSEKHGGR
IRERSSDNVRLSGYSAMRCWKKRLCACLQCQKRDSIPATFYRPYFRIVRFDVSAMEKNAS
NLVKAEFRVFRLQNPKARVSEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFD
VTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGSFTYSSG
DLKTLKSARKKNSGKSPHLLLMLLPSYRLESQQSSRRKKRALDAAYCFRNVQDNCCLRPL
YIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVS
QDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgctctctgctgagcgtcgtcctgaccctggatctggtgacggcggcgctgagc
ctgtctacctgcagcaccctcgacatggatcagttcatgcgcaagcggatcgaggccatc
cgggggcagatcctcagcaaactgaagctgaccagcccccccgaagactaccccgagccg
gaggaggtccccccggaggtggtgtccatctacaacagcacccgggacttgctgcaggag
aaagccaaccagagggcggccgcttgcgagagggagcgcagcgacgaggaatattacgcc
aaagaggtctacaaaatcgacatgctgccctatttcccctccgaaaaacacggcggcaga
attagggaacgttcttccgacaatgtgcgtctgtctggatacagcgcaatgcgatgttgg
aagaaacggttgtgcgcatgtttgcagtgtcagaagcgggattccatcccagccaccttt
tacagaccctacttccggattgtcagattcgacgtctcggccatggagaagaacgcctcc
aacctggtaaaggccgagttccgggtcttccgtttgcagaatcccaaggcccgggtgtct
gaacaacgaatagaactctatcagattctcaagtccaaagatttaacttcaccgacccag
cgctacattgatagcaaggttgttaaaacacgtgccgaaggggaatggctctctttcgat
gtcaccgacgccgtgcatgaatggctacaccataaagacaggaacctgggatttaagatc
agtttacactgtccctgctgcacctttgtaccatccaacaattacatcatcccaaataaa
agtgaagaactagaagcaagatttgcaggtattgatggctccttcacatattccagtggt
gatctgaaaactttaaagtccgctaggaaaaaaaacagtgggaagagcccacatctcctg
ctaatgttgttaccctcctacagacttgagtcgcaacaatccagccggcggaagaaacgg
gctctagatgctgcctattgctttagaaatgttcaggataattgctgcctgcgtccactt
tacatagatttcaagagggatcttggttggaaatggatccatgaacctaagggctataac
gccaatttctgtgcaggcgcctgcccgtatctatggagttctgatactcagcacagcaga
gtactcagcttatataataccataaacccagaagcttctgcatctccttgctgtgtctcc
caggatttggaacccctcaccatcctatattacatcggcaaaacacctaaaattgaacag
ctgtccaatatgatcgtaaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system