KEGG   Ornithorhynchus anatinus (platypus): 100080362Help
Entry
100080362         CDS       T01045                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04022  cGMP-PKG signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04114  Oocyte meiosis
oaa04140  Autophagy - animal
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04210  Apoptosis
oaa04218  Cellular senescence
oaa04270  Vascular smooth muscle contraction
oaa04370  VEGF signaling pathway
oaa04371  Apelin signaling pathway
oaa04380  Osteoclast differentiation
oaa04510  Focal adhesion
oaa04540  Gap junction
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04620  Toll-like receptor signaling pathway
oaa04650  Natural killer cell mediated cytotoxicity
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04666  Fc gamma R-mediated phagocytosis
oaa04668  TNF signaling pathway
oaa04720  Long-term potentiation
oaa04722  Neurotrophin signaling pathway
oaa04725  Cholinergic synapse
oaa04726  Serotonergic synapse
oaa04730  Long-term depression
oaa04810  Regulation of actin cytoskeleton
oaa04910  Insulin signaling pathway
oaa04912  GnRH signaling pathway
oaa04914  Progesterone-mediated oocyte maturation
oaa04915  Estrogen signaling pathway
oaa04916  Melanogenesis
oaa04917  Prolactin signaling pathway
oaa04919  Thyroid hormone signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04926  Relaxin signaling pathway
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04934  Cushing's syndrome
oaa05020  Prion diseases
oaa05034  Alcoholism
oaa05161  Hepatitis B
oaa05164  Influenza A
oaa05165  Human papillomavirus infection
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05200  Pathways in cancer
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05212  Pancreatic cancer
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05216  Thyroid cancer
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05230  Central carbon metabolism in cancer
oaa05231  Choline metabolism in cancer
Module
oaa_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100080362 (MAP2K1)
   04015 Rap1 signaling pathway
    100080362 (MAP2K1)
   04010 MAPK signaling pathway
    100080362 (MAP2K1)
   04012 ErbB signaling pathway
    100080362 (MAP2K1)
   04370 VEGF signaling pathway
    100080362 (MAP2K1)
   04371 Apelin signaling pathway
    100080362 (MAP2K1)
   04668 TNF signaling pathway
    100080362 (MAP2K1)
   04066 HIF-1 signaling pathway
    100080362 (MAP2K1)
   04068 FoxO signaling pathway
    100080362 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100080362 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100080362 (MAP2K1)
   04024 cAMP signaling pathway
    100080362 (MAP2K1)
   04022 cGMP - PKG signaling pathway
    100080362 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100080362 (MAP2K1)
   04150 mTOR signaling pathway
    100080362 (MAP2K1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100080362 (MAP2K1)
  Cell growth and death
   04114 Oocyte meiosis
    100080362 (MAP2K1)
   04210 Apoptosis
    100080362 (MAP2K1)
   04218 Cellular senescence
    100080362 (MAP2K1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100080362 (MAP2K1)
   04540 Gap junction
    100080362 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100080362 (MAP2K1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100080362 (MAP2K1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100080362 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100080362 (MAP2K1)
   04660 T cell receptor signaling pathway
    100080362 (MAP2K1)
   04662 B cell receptor signaling pathway
    100080362 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100080362 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100080362 (MAP2K1)
   04062 Chemokine signaling pathway
    100080362 (MAP2K1)
  Endocrine system
   04910 Insulin signaling pathway
    100080362 (MAP2K1)
   04912 GnRH signaling pathway
    100080362 (MAP2K1)
   04915 Estrogen signaling pathway
    100080362 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100080362 (MAP2K1)
   04917 Prolactin signaling pathway
    100080362 (MAP2K1)
   04921 Oxytocin signaling pathway
    100080362 (MAP2K1)
   04926 Relaxin signaling pathway
    100080362 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100080362 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100080362 (MAP2K1)
   04916 Melanogenesis
    100080362 (MAP2K1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100080362 (MAP2K1)
  Nervous system
   04725 Cholinergic synapse
    100080362 (MAP2K1)
   04726 Serotonergic synapse
    100080362 (MAP2K1)
   04720 Long-term potentiation
    100080362 (MAP2K1)
   04730 Long-term depression
    100080362 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100080362 (MAP2K1)
  Development
   04380 Osteoclast differentiation
    100080362 (MAP2K1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100080362 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100080362 (MAP2K1)
   05231 Choline metabolism in cancer
    100080362 (MAP2K1)
   05206 MicroRNAs in cancer
    100080362 (MAP2K1)
   05205 Proteoglycans in cancer
    100080362 (MAP2K1)
   05210 Colorectal cancer
    100080362 (MAP2K1)
   05212 Pancreatic cancer
    100080362 (MAP2K1)
   05225 Hepatocellular carcinoma
    100080362 (MAP2K1)
   05226 Gastric cancer
    100080362 (MAP2K1)
   05214 Glioma
    100080362 (MAP2K1)
   05216 Thyroid cancer
    100080362 (MAP2K1)
   05221 Acute myeloid leukemia
    100080362 (MAP2K1)
   05220 Chronic myeloid leukemia
    100080362 (MAP2K1)
   05218 Melanoma
    100080362 (MAP2K1)
   05211 Renal cell carcinoma
    100080362 (MAP2K1)
   05219 Bladder cancer
    100080362 (MAP2K1)
   05215 Prostate cancer
    100080362 (MAP2K1)
   05213 Endometrial cancer
    100080362 (MAP2K1)
   05224 Breast cancer
    100080362 (MAP2K1)
   05223 Non-small cell lung cancer
    100080362 (MAP2K1)
  Neurodegenerative diseases
   05020 Prion diseases
    100080362 (MAP2K1)
  Substance dependence
   05034 Alcoholism
    100080362 (MAP2K1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100080362 (MAP2K1)
  Infectious diseases
   05164 Influenza A
    100080362 (MAP2K1)
   05161 Hepatitis B
    100080362 (MAP2K1)
   05163 Human cytomegalovirus infection
    100080362 (MAP2K1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100080362 (MAP2K1)
   05165 Human papillomavirus infection
    100080362 (MAP2K1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100080362 (MAP2K1)
   01522 Endocrine resistance
    100080362 (MAP2K1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100080362 (MAP2K1)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: STE group
  STE7 family
   100080362 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 Kinase-like
Motif
Other DBs
NCBI-GeneID: 100080362
NCBI-ProteinID: XP_001511248
Position
Un
AA seq 327 aa AA seqDB search
MPMPRKKPDPIQLNPTPDGAAVNGTSSAELWLIHLEIKPAIRNQIIRELQVLHECNSPYI
VGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKI
MHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDI
WSMGLSLVEMAIGRYPIPPPDSKELELMFGCTVEGDASETSPRQRTPGRPISSYGLDNRP
PMAIFELLDYIVNEPPPKLPNGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRAEA
EDVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgcccaggaagaagcccgaccccatccagctcaaccccaccccggacggggcc
gccgtcaacggcaccagctccgccgagctctggctcatccacctagagatcaagccagcc
atccggaaccagatcatccgggagctgcaggtgctccacgaatgcaactccccttacatc
gtgggcttctatggggccttctacagtgatggcgagatcagcatctgcatggagcacatg
gatggcgggtccttggatcaggtcctgaagaaagccggaagaattccagagcagattctg
ggcaaagttagcattgctgtaataaaaggtctaacgtatctgagggagaaacataaaatt
atgcacagagacgtgaagccgtccaacatcttggtgaactcccgcggtgagatcaagctc
tgcgacttcggggtcagcgggcagctgatcgactccatggccaactcctttgtgggcacg
aggtcctacatgtcgccggagagactacaaggcactcattattcagtgcagtcggacatc
tggagcatgggcttatccttggtggagatggctattggcaggtacccgatccctcctccc
gattccaaggagctggaactgatgttcggatgcacggtggagggagacgcttcggagacg
tcgccccgacagcggaccccggggaggcccattagctcttacggcctggacaacagacca
cccatggccatctttgaactgctggactatatcgtcaacgagccgccgcccaagctgccc
aatggagtcttcagtcttgagtttcaagattttgtgaataaatgcctcatcaaaaacccg
gccgagagagccgacctgaagcaactcatggttcacgctttcatcaagagagccgaggcg
gaagacgtggactttgcgggctggctgtgctccaccataggcctgaaccagcccagcacg
cccacccacgccgccggagtgtaa

DBGET integrated database retrieval system