KEGG   Ornithorhynchus anatinus (platypus): 100081215Help
Entry
100081215         CDS       T01045                                 

Gene name
QRSL1
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial isoform X1
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00970  Aminoacyl-tRNA biosynthesis
oaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100081215 (QRSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oaa03029]
    100081215 (QRSL1)
Enzymes [BR:oaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100081215 (QRSL1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100081215 (QRSL1)
Mitochondrial biogenesis [BR:oaa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100081215 (QRSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 100081215
NCBI-ProteinID: XP_001512042
UniProt: F7A3P2
Position
19
AA seq 524 aa AA seqDB search
MLGLTLREISAALKQGQVSPIELCQRCLSRIKETKFLNAYITVTEERALKQAAESEKRYE
KGQELGVLDGIPFSVKDNFSTAGIETTCASNMLKGYVPPYNATVVQKLLDQGAVLMGKTN
LDEFAMGSGSTDGVFGPVRNPWSYSKQYRGKGSPDSSQEDQEPQWLVAGGSSGGSAAAVA
AFTCFVALGSDTGGSTRNPAAHCGVVGLKPTYGLVSRHGLIPLVNSMDVPGILTRCVEDA
AIILEVLAGHDPKDSTTVQDLVSPLALPSSVDISKLCIGIPKEYRAEGLSCETQAFWTRA
ADLFQSAGARVIEVSLPHTSYSIDCYHVLCTAEVASNMARFDGLEYGHRCNRDVSTEAMY
AATRREGFNDVVRGRILSGNFFLLKENYNDYFIKAQKVRRLIANDFIHVFSSGVDVLLTP
TTLSDAVPYLEFIKEDNSTRSAQDDVFTQAVNMAGLPAVTVPAARSKRGLPVGLQFIGRA
FCEQQLLTVAKWFEQEVRFPALCLEDLTEAGLVAARHEKSVSVS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcctgaccctccgagaaatttctgctgctctgaaacaaggccaagtaagccca
atagagctgtgtcaaagatgtctctcccgcatcaaagaaaccaagtttcttaatgcttat
attactgtgacagaagaaagggctttaaaacaagctgcggaatctgagaaaaggtatgaa
aaagggcaggaactgggagttttagatggaattcccttttcagtaaaagacaacttcagc
accgcgggtattgagacaacatgtgcatcaaatatgctgaaaggttatgtacccccttat
aatgctacggttgttcagaagttgttggatcagggggctgtgcttatgggaaaaacaaac
ctagatgagtttgctatgggatctggaagcacggatggggtcttcggcccagtcagaaac
ccctggagctactccaagcagtaccgggggaagggtagcccggattccagccaagaggac
caggagccacagtggctggtggctggagggagctccgggggaagcgctgctgcagtggct
gccttcacttgtttcgtggctttgggatctgatacgggcgggtcgaccagaaacccagcc
gcccactgcggcgttgttgggttaaagcccacatatgggctggtttcccgtcacggccta
atcccactggtgaattcaatggacgtgccaggcatcttgaccagatgtgtggaggatgca
gccatcatcttggaggtcctggctgggcacgaccccaaagattctaccacggtgcaagac
cttgtcagtccacttgccctccccagttcagtggacatcagcaagttgtgcatagggata
ccaaaggaataccgagctgaagggctgtcctgtgaaactcaagccttttggaccagagct
gctgacctcttccaaagtgctggggccagagtgattgaagtgtcactgccccacaccagt
tactcaatagactgctatcatgtgctgtgcacagcagaagtggcatcaaacatggcgaga
tttgatgggctggaatatggtcaccggtgtaacagagacgtgtccacagaggccatgtat
gctgcaaccagacgagaagggttcaatgatgtcgtaagaggaagaattctctcaggaaac
tttttccttctaaaagagaactacaatgactacttcatcaaagcacagaaagtgaggcga
ctcattgccaacgacttcatccatgtcttcagttctggcgtggatgtgctgctcacgccc
acgaccctgagcgatgccgttccctacctggagttcatcaaggaagacaacagcaccagg
agtgcccaggatgatgtgtttacccaggccgtgaatatggccggtctgcctgcggtaact
gtcccagctgctcgctcaaagcgagggctgccagtcggactccagttcatcggccgggca
ttctgcgagcagcagcttctcacagttgctaaatggttcgaacaagaagtcagattccct
gccctgtgcctcgaggatctgacggaggcaggcctggtggctgctcggcatgagaagtcg
gtctctgtgtcctag

DBGET integrated database retrieval system