KEGG   Ornithorhynchus anatinus (platypus): 100081497
Entry
100081497         CDS       T01045                                 
Name
(RefSeq) myosin-16
Organism
oaa  Ornithorhynchus anatinus (platypus)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Crescentin IQ AAA_29 AAA_16
Other DBs
NCBI-GeneID: 100081497
NCBI-ProteinID: XP_001511881
Ensembl: ENSOANG00000007722
Position
2:complement(36502335..36562295)
AA seq 1945 aa
MPGGYKGECGDDVDPMPFLAPPEKERIEAMNKPYDIKKSCWVKDEKEGFVAGEIQSEQGD
QVTVKTVTNQTVTMKKEDIQQMNPPKFYQANDMADMTFLNEASVLNNLRQRYINMRIYTY
SGLFCVTVNPYKWLPIYGARVANMYKGKKRTEMPPHLFSISDNAYHDMLMDRENQSMLIT
GESGAGKTENTKKVIQYFANIGGTGKQSTDGKGSLEDQVIQANPVLEAFGNAKTIRNNNS
SRFGKFIRIHFGPSGKLAGADIESYLLEKSRVISQQAAERGYHIFYQILSNKKPELLESL
LLVPNPKEYQWISQGVTVVDNMDDGEELQITDVAFDVLGFTAEEKIGVYKLTGGIMHFGN
MKFKQKPREEQAEVDTTEVADKVAHLMGLNSGELQKGITRPRVKVGNEFVQKGQNMDQCN
NSIGALGKAIYDKMFKWLVVRINKTLDTKMQRQFFIGVLDIAGFEIFEFNSFEQLCINFT
NEKLQQFFNHHMFVLEQEEYKREGIDWVFIDFGLDLQACIDLLEKPMGIFSILEEQCVFP
KATDATFKAALYDNHLGKSNNFLKPKGGKGKGPEAHFELVHYAGTVGYNITGWLEKNKDP
LNETVVGLFQKSSLGLLGVLFKEEEAAAGSKKQKRGSSFMTVSNFYREQLNKLMATLHST
APHFVRCIVPNEFKQSGVVDAHLIMHQLACNGVLEGIRICRKGFPNRLQYPEFKQRYQVL
NPSVIPQGFVDNKKASELLLGSIELDVNEYKIGHTKVFFRAGVLAKLEDMRDDRLSKIMI
MLQCQLRGYLARIEFKKMLDMRIGLTVIQRNVRKFLQLRYWGWWKLYNKVKPLLNVARQE
EEMKAKEEELRNAMAKTQELINRIKELEEKSATLGQEKNDLTIQLQAEQENLSDAEERLT
QLMKTKMELESQLCDMRERLEEEEGTAASLSATKRRLEGEMSDLKRDLEGLETTLAKTEK
EKQALDHKVRTLSGDLSLRDDSITKLQKEKRALDELHQKTLDDLQAEEDKVNHLTKNNSK
LGTQIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNEMERSKLDLEEVVKKRDME
INSVNSKYEDEQSLNSTLQRKLKEHQARIEELEEELEAERAMRAKVEKQRSDLSRDLEDL
SDRLEEAGGATSAQIEQNRKREAELLKLRRELEEAALQSEATASTLRKKHTDSMAELSEH
VENLQRVKSKLEKDKQVMKAEIDDLSASMETVQKSKVNAEAHVRKLEDSLSEANAKVAEL
ERNQAEINAIRTRLQAENGELSREHEESQSRLNQIIRMKTSLTSQVDEFKRQLDEESKSR
SAAVVSLANTKHDLDLIKEQLEEEQAGKSELQRLVSKLNTEVTTWRTKYETDAIQRTEEL
EETKRKLAARLQEAEETAEAAQARAATLEKNKQRLQAEVEDLTIDLEKANAAAAALDKKQ
RVFDKMLAEWQQKCEELQVEVDSSQKECRMYMTENFKIKTAYEESLEHLESVKKENKTLQ
EEIKDLIDQLGEGGRSVHELQKLKKKLEIEKEELQVALEEAESSLEVEESKVIRIQLELA
QVKADIDRRIHEKEEEFEATRKNHQRAIESLQTSLEAEAKGRAEALRLKKKMETDLNEME
IQLDHANKNNSELVKTLKRLQQQIKDLQVQMDEDARQHEELREQYNLQERRLSLLQTELE
EVRSALEGSERSRKLLEQEVVEITERHNEVNIQNQSLLVIKRKLESDVQRISNEHEELLS
EFRTADERAKKAMADASRMAEELRQEQDHCMHLEKIKKNYEITIKDLQAKMEEAEQLALK
GGKRTIMKLEARIKEVETELDAEQKRHVETVKVLRKNERRLKELVFQTDEDHKTNQRMQE
LVEKLQNKLKVYKRQIDEAEEQANQSMARYRKTVHELDDAEERAGMAESALNKLRSRHRV
SSKGITAVEIIQVSKTGSSKNISEE
NT seq 5838 nt   +upstreamnt  +downstreamnt
atgcctggtgggtacaaaggagaatgtggggacgatgtggatcccatgccatttctggca
cccccagagaaggagaggattgaggccatgaacaagccttatgacatcaagaagtcctgc
tgggtaaaggatgagaaggagggtttcgtcgcaggggagatccagtctgaacaaggagac
caagtcaccgtaaagacggtcaccaatcagacggttactatgaagaaagaagatatccaa
cagatgaaccctcccaagttctaccaggccaatgacatggctgacatgacctttctgaat
gaggccagtgtcctgaacaacctgcgccaacgctacatcaacatgaggatctacacctac
tcggggttgttctgtgtgaccgtcaacccctataagtggctgcccatctatggagctcga
gtggccaacatgtacaagggcaagaaacgcactgaaatgcctccgcatctcttctccatt
tctgacaacgcctaccatgacatgctcatggatcgtgaaaatcagtctatgctaatcact
ggagaatccggtgccggcaagactgaaaacacaaaaaaggtcattcagtattttgccaat
atcggaggcacaggcaaacagtctacggacggtaagggatccctggaagatcaagtcatc
caggccaatcccgtgctagaggcctttgggaatgccaagactatcaggaacaacaattca
tctcgctttggcaagtttatcagaatccattttggcccttctggcaaactggctggggct
gacatagagagttatctcttagagaaatctcgggtcatttcccagcaggcagctgagaga
ggttaccatatcttctatcagatcctctctaataagaagcctgaacttcttgaaagtttg
ctgctggtgcccaatcccaaggaataccaatggataagccagggtgttactgtagtcgac
aacatggatgatggtgaagagttacagatcacggatgttgcttttgatgttctgggattc
actgcagaggagaagattggtgtctataaactgactgggggcattatgcattttggaaac
atgaagttcaagcagaagccacgagaggagcaagcagaagtggacaccactgaggtggct
gataaggtcgcccacctcatgggcctcaactccggggaactccagaagggcattacccgg
cctcgagtgaaagtgggcaatgaatttgtgcagaaaggtcaaaacatggaccagtgcaat
aactctatcggtgctttgggcaaagccatctatgacaagatgtttaagtggctggtcgtc
aggatcaacaagaccttagacaccaagatgcagaggcagttcttcatcggggtgctggat
attgccggctttgagatctttgagtttaacagctttgaacaactgtgcattaatttcacc
aatgagaaactacagcagttcttcaaccaccacatgtttgtgctggagcaggaggagtat
aagagagaaggcattgactgggtcttcattgactttggcctggacctgcaagcgtgcatt
gaccttctggaaaagcccatgggcatcttctccattctggaagagcagtgcgtgttcccg
aaagccacggatgccactttcaaggctgccttgtatgataaccatttaggaaaatcaaac
aacttccttaagcccaagggaggtaaaggcaaagggccagaggcccattttgagctggtc
cactacgccggcaccgtgggttacaacatcactggctggctggagaaaaataaggaccca
ctcaatgaaacagtggtgggcttgttccagaaatccagtctgggcctccttggcgtcctt
ttcaaagaagaagaggctgcagctgggagcaagaaacagaaaagaggatcttccttcatg
actgtctccaacttctacagggagcagctgaacaaattgatggccacactgcacagcacc
gccccccactttgtccgatgcattgtccccaatgagttcaagcagtctggggtggtggat
gctcatctgatcatgcaccagttggcgtgtaacggcgtcctcgaaggcatccgtatttgc
aggaagggcttccccaacaggctgcagtatcctgaattcaaacagagataccaagtgttg
aaccccagcgtgatcccacagggatttgtggacaacaagaaggcctcagaactgctgctt
ggctctatcgaactagatgtgaatgaatacaaaatcggacacaccaaggtgttcttccgg
gctggagtcttggccaagcttgaagatatgcgagacgaccgtctgtcaaagattatgatc
atgttgcagtgccaacttcggggttacctggcgaggattgaattcaagaagatgctagat
atgagaatcggcctgacagtcattcagcggaatgttcgcaagttcctgcaactgcggtac
tggggctggtggaaactctataacaaggtgaagcccctcctgaatgtggccaggcaggaa
gaagagatgaaagcaaaggaagaagagttgaggaatgcgatggccaagacacaggagctg
atcaaccgcatcaaggaactggaggaaaaatcagctaccctcggccaggagaagaatgac
ctgaccatccagcttcaggctgaacaagagaacctgtcggatgcggaagagcgcctgacc
cagttgatgaagaccaagatggagttggagagccagctctgcgacatgagggagcggctg
gaggaagaagagggcaccgcggcctccttgagcgctacgaagcgcagactggaaggggag
atgagtgacctgaagcgggatctggaaggcctggaaacgaccttggctaagacagaaaag
gagaaacaggcactggatcacaaagtgcgtaccttgagtggcgacctctccttgcgcgac
gactccatcaccaagctccagaaggagaagcgggccttggatgagcttcaccagaaaact
cttgatgaccttcaagctgaggaggacaaggtgaaccacctaaccaagaacaatagcaaa
cttgggactcagatacatgagttggaggacaactgggaacaagaaaagaagatccgggct
gaggtggagaaagcccgtcggaaggccgagagtgacctgaagatgaccatcgacaacctc
aatgagatggaaagatcaaaattagatctggaggaggtggttaagaagagagacatggaa
ataaattctgtcaactcaaaatatgaagatgagcaatccttgaattccacactgcaaaga
aagctaaaggaacaccaggcccgtatcgaagagcttgaagaagaattggaagctgaacgt
gctatgcgagcaaaggtagagaaacaacgtagcgacctgtcccgggatcttgaagacctc
agtgacaggctggaagaggctggaggtgccacatctgcgcagatcgaacagaaccgcaag
cgagaagccgaactgctgaagctgaggcgggagttggaagaggcagccctgcagagcgag
gccacggcctctaccctacgcaaaaagcacacggattccatggctgagctatcggaacac
gtggagaatctccagagggtcaagtccaagttggagaaggacaagcaagtcatgaaggcc
gagatcgatgacctcagtgccagcatggagacagtacagaaatctaaggtgaatgctgag
gctcatgtccgcaagctggaagacagtttgtctgaggctaatgctaaagtggctgaactg
gaacggaaccaagcagaaattaatgccattaggaccaggctccaagctgagaatggggag
ctgagtcgggagcatgaagaatcccagagccggcttaatcagatcatccggatgaagact
tccctgacctctcaagttgatgagttcaagaggcagctggatgaagagtctaagtcccgc
agtgccgctgtcgtgagcctggccaacaccaagcacgatctggacctcatcaaggagcaa
ctggaggaggaacaagcgggcaagtctgagctgcagcgcctggtctccaagctcaatact
gaggtgaccacctggaggaccaagtacgagactgacgccattcaaagaaccgaggagctg
gaagagaccaagaggaaattggctgcaaggctccaggaggcagaagagaccgcagaagca
gcccaggcccgtgctgcgactctagagaaaaacaaacagagacttcaggcagaagtagag
gacctaactattgacctggagaaggccaatgcagcggctgccgccctcgacaagaaacag
cgggtctttgataagatgctggctgagtggcagcagaagtgcgaagaactgcaggtggag
gtggacagttcccagaaggagtgccggatgtacatgacggagaacttcaagatcaagacc
gcctacgaggagtccttggagcacctggaatctgtgaagaaggagaacaagaccctccag
gaggagattaaggatctaatcgatcagctgggagagggaggtcggagtgtgcacgagctt
cagaagttgaagaagaagcttgagattgagaaggaagaactgcaggtggctctagaggaa
gctgaatcttccctggaggtggaagagagcaaagtaatccgtattcaactggagctggct
caggtgaaagctgacatagatagaagaatccatgagaaggaagaggaatttgaggctaca
aggaagaaccaccaacgggcaatcgagtccttgcagaccagcctggaggccgaggctaag
ggacgtgcagaagccctccggctcaagaagaaaatggagacggatttgaacgaaatggaa
atccaactggatcacgcgaacaagaacaacagcgagctggtcaagacgctgaaaaggctg
cagcagcaaatcaaggatctccaggtccagatggacgaggatgcccgccaacacgaagag
ctccgggagcagtacaacctccaagagcgtcggctgagcctgctgcagaccgagttggaa
gaagtgcgctctgctctggaggggagcgagcggtctcgcaagctcttggaacaagaagtg
gtggagatcacggagaggcacaacgaggtcaacatccagaaccaaagcttgctggtgatc
aaacgtaagctcgaatctgatgtccagcgcatctccaacgaacacgaagagctcctcagc
gagttccggacagcagatgagagagccaagaaagcgatggctgacgcgtcccgcatggct
gaagaattgcggcaggagcaggatcactgcatgcacctggagaagatcaagaaaaactat
gagatcaccatcaaggaccttcaggccaagatggaagaggccgagcaactggccctgaaa
ggaggaaagcgtacaataatgaagctggaggcgcggatcaaggaagtggaaaccgaactg
gatgcggagcagaaacggcacgtagagacggtcaaagtcctgcggaaaaatgaacgccgt
ctcaaagaactggtcttccaaacggatgaggatcacaagaccaatcaacgcatgcaagag
ctggtggagaagctgcagaacaagctgaaagtctacaagaggcaaattgacgaagccgag
gaacaggctaaccagagcatggccaggtacaggaagaccgtgcacgagctggacgatgcg
gaggaacgagcgggcatggccgaatccgctctgaataagctgcgctccaggcatcgcgtc
tcaagcaaaggaatcaccgctgtggagatcatccaagtgtccaagaccgggtcctccaaa
aatatctctgaggaataa

DBGET integrated database retrieval system