KEGG   Ornithorhynchus anatinus (platypus): 100081570
Entry
100081570         CDS       T01045                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oaa01002]
    100081570
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100081570
Peptidases and inhibitors [BR:oaa01002]
 Metallo peptidases
  Family M1
   100081570
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100081570
NCBI-ProteinID: XP_028928855
Position
1
AA seq 941 aa
MPAFPSPSCKWPFATPAALILLIVANSAWSQSNETAPLLASNGEPFPWHQMRLPRHVLPV
HYELMIHANLTTLTFLGFTEILVSVHQATSAIILHSKDLHVTMVTLWEGSRASHPGRKLT
VLEYLPYEQVALVSAEPLRVGRQYTVAIEYTGTLSESFHGFYKSTYRTQEGEVRTLASTQ
FEPTAARMAFPCFDEPAFKATFAVKIRRDTRHLALSNMPIVRSVSVAEGLVEDQFDVTVK
MSTYLVAFIVSDFKSVSKMTKSGIKVSVYAVPEKINQTGYALDAAVTLLEFYEDYFSIPY
PLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDPEKSSASAKLGITMIVAHELAHQWFG
NLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNAMEVDALNSSHPIST
PVENPAQILEMFDDVSYEKGACILNMLRDYLSADGFKAGIVQYLQKNSYKNTNNEDLWNS
MTNICPDGDPQEKSGFCSRSQRKTSTSHWTQESVDVRMMMNTWTLQKGFPLITVTVRGKN
VHLKQEHYMKGRVATWEDRSLWHVPLTYVTSKSDVVHRFLLKTKTDVLILPEEVEWIKFN
AGMNGYYIVHYEDGGWDSLISLLKEQPETISSNDRASLINNAFQLVSVGKLSIEKALDLT
LYLKHESQIMPVFQGLNELIPMYKLMEKRDMDDVETQFKAFLIRLLKGLIDKQSWSDEGS
VSERMLRSQLILLACIRKYQPCVEKAEGFFKSWKESNGTLRLPTDVTLAIFAVGAQTDAG
WDFLFHKYQSSLSSTEKSQIEFALCISSNPDKLQWLLDQSFQGNVIKTQEFPYILSMVGR
NRVGYPLAWKFLKENWNGLVKKFELGSTSLAYMVTGTTNQYSTRARLEEVKGFFSSLKEN
GSQLRCVQQTVETIEENIRWMDANFEKIKVWLQNQSKGVEL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgcctgcctttccctccccatcctgcaaatggccatttgcaactccagccgccttgatc
ctcttaatcgtggcaaattctgcgtggagccagagcaatgaaactgcccctctgctcgct
agtaacggagaaccgtttccctggcatcagatgagacttcctcgacatgtcctcccagtt
cattatgaactcatgatccacgccaatctcaccaccctgaccttcctaggattcactgag
atcttagtttcagtccatcaggcaaccagtgccatcatcctgcacagcaaagacctgcac
gttaccatggtgactctttgggaggggtccagagccagtcaccccgggaggaagctgacc
gtgttagaatatcttccgtatgagcaggtggcccttgtatctgccgagccgctccgtgtc
ggacggcagtatacggtagccatcgaatacactggtactctttcggagagtttccatggc
ttttataaaagcacctacaggactcaggaaggtgaagtaaggactcttgcatccacccag
tttgaaccgacggcagcccgtatggcttttccctgtttcgacgagccggccttcaaagcc
acttttgcggttaagatcagaagagataccagacatttggccctctccaacatgccaatt
gtgagatcggtgagtgttgcagaaggcctcgtggaggaccagtttgatgtcactgtgaag
atgagcacataccttgtggccttcattgtttcagatttcaaatccgtcagcaagatgacc
aaaagcgggatcaaggtttccgtgtatgctgtacctgagaaaataaaccaaaccggctat
gctttagatgctgcagtaacccttttagagttttatgaggattattttagtattccctat
ccccttcccaaacaagatctagctgccatccccgactttcagtccggggccatggagaac
tggggcctcaccacgtaccgagagtcatctctgctgtatgaccctgaaaagtcatctgca
tcagccaagctggggatcaccatgatagtggcccatgaactggcccaccagtggtttggg
aacctcgtcaccatggaatggtggaacgatctctggttaaatgaaggatttgccaagttt
atggagtttgtatctgtcagcgtcacccaccctgaactgaaagtggaagattattttttc
ggcaagtgtttcaatgccatggaagtggatgcgttgaactcctcccacccgatctctact
cctgtggagaatcccgctcagattctggaaatgttcgacgacgtctcctacgaaaagggg
gcttgtattttgaacatgctaagggactatctcagtgcagatggattcaaagccggtatt
gtgcagtacctccagaaaaacagctataaaaacacaaacaatgaagacctgtggaatagc
atgacaaatatttgtcctgatggtgacccccaggagaaaagtggattttgctctagaagt
cagaggaagacttcaacctcacactggacgcaggaaagcgtggatgtgaggatgatgatg
aacacgtggaccctgcagaagggtttccctctgatcaccgtcaccgtccgaggaaagaat
gtgcatctgaagcaagagcactacatgaaggggagggttgccacctgggaagacaggtcc
ttatggcacgttccgctgacatacgtaaccagcaaatcagatgttgtccataggtttttg
ctgaaaacaaaaacagatgtcctcatactgcccgaagaggtggaatggatcaaattcaac
gcgggcatgaacggctactacattgtgcattacgaagacggtggatgggattctttgatc
agcctcttaaaagagcagccggagacaatcagcagtaatgaccgggcaagcctcattaat
aatgcattccagcttgtcagtgtggggaaactctccattgaaaaggctctggatttgacc
ctgtatctgaaacacgaatcacaaatcatgccagtgttccaaggtctgaacgagctgatt
cccatgtataagctaatggagaagagagatatggatgatgtggaaacccagttcaaggct
ttcctcatcaggctgttgaaggggctcatcgacaagcagtcttggagtgacgagggctcc
gtctctgagcgtatgctgcgaagccagctcatcctcctggcttgcatacggaagtaccag
ccctgtgtggagaaggcagaaggattctttaaatcgtggaaggaatccaatggaacatta
agattgccaaccgacgtgaccctggccatcttcgccgttggggcccagacagacgcgggc
tgggacttcctcttccacaagtatcagtcgtccctatccagcacggaaaagagccagata
gaatttgctctctgtatcagcagtaatccagacaaactccagtggttgcttgatcaaagt
ttccagggcaatgtgataaagacccaagagttcccatacattctctcaatggttggcaga
aaccgggttggctatcctttggcctggaagtttcttaaggaaaactggaacggtctcgtc
aaaaagtttgaacttggctcaacatccttagcgtacatggtaaccggaacaaccaatcag
tactcgacgagagcccggctcgaagaggtgaaaggattcttcagctccttgaaagaaaat
gggtcccagcttcgctgtgttcaacagacagtggaaacgatcgaagaaaacatacgctgg
atggacgcaaactttgaaaagatcaaagtgtggttgcaaaatcaaagcaaaggagtggaa
ctgtag

DBGET integrated database retrieval system