KEGG   Ornithorhynchus anatinus (platypus): 100082409Help
Entry
100082409         CDS       T01045                                 

Gene name
H6PD
Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein isoform X1
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00030  Pentose phosphate pathway
oaa01100  Metabolic pathways
oaa01200  Carbon metabolism
Module
oaa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
oaa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100082409 (H6PD)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     100082409 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     100082409 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N SPP
Motif
Other DBs
NCBI-GeneID: 100082409
NCBI-ProteinID: XP_028921217
Position
5
AA seq 807 aa AA seqDB search
MRGPPLPLASAARGLPTMLKATFCMAFLLGAVLAQEPRGHVSVVLLGATGDLAKKYLWQG
LFQLFVDEADRGHSLSFHGAALTAPEQGQRLLAEALKRLSCPADVAPEPCATLKDRFLQL
SQYRQLKTAENFAALSRDIEERLQQEGLREAGRIFYFSVPPFAYAEIARHINSSCRPSPG
AWLRVVLEKPFGHDYQSAQKLAVELRSFFQEEEMYRVDHYLGKQAVAQILPFRDQNREAL
DPIWNRHHVDRVEIVLKETVDAAGRTSFYEEYGVIRDVIQNHLTEILLSVAIELPRNVSS
SEQVLRHKLKTFQALRSLERASAVLGQYQAYSAQVREELQKPASYGSLTPTFAGILIHVD
TLRWEGVPFILTSGKAMDERVGYVRILFKNRAYCAQSESHRDTGKSQCQPRQIIFYIGHG
DLGSPAVLVSRNLFEPRLSLESWREMPERPGLQLFGLPLSAYHAYGPVRERDAYSILISH
IFHRRKDAFITSENLLASWDFWTPLLDSLAQQVPRLYPGGSENGPLLDFEVEGRQVSFVQ
GQPEQLIPGLGSAQTPSDFRVLDARFRQSPLVSAWPEELISRLADDIEAAAEEAVRHSGE
FHLALSGGSSPVALFQRLATRHFGFPWAHTHLWLVDERCVPLTDPESNFQGLQAHLLQHI
RMPYCNVHPMPVHLHRRLCVEADQGVELYAKEIAALVGNISFDLVLLGMGADGHTASLFP
HSPSGLDGEQLVVLTESPSKPHQRMSLSLPLINRAKQVAVLVMGKNKRDITSLVSRVGHE
PRKWPISGVLPSSGHLVWYMDYDAFLG
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggccccctctccccttggcttcggcagctcggggcctcccgacaatgctgaag
gccacgttctgcatggctttcctcctgggggctgtgttagcccaggagcctcggggtcac
gtgtcggtggttctactgggggccaccggggacctggccaagaagtacctgtggcagggg
ctcttccagctgttcgtggatgaagcagatcggggtcacagtctcagtttccacggggcg
gccctgacggcccctgagcaggggcagcgcctcctggcagaagccctgaagcggctctcc
tgcccggccgacgtggcgcccgagccctgtgccaccctcaaggaccgcttcctgcagctg
agccagtaccgccagctgaagacggccgagaacttcgcggccctgagccgggacatcgag
gagcggctccagcaggaggggctgagggaggccggcaggatcttctacttctcggtgccc
cccttcgcttacgcagaaatcgcccgacatatcaacagcagctgccggccgagcccgggg
gcctggctgcgggtggtactggagaaacccttcggccatgactaccagtcggcccagaag
ctggcggtggagctcaggtctttcttccaggaggaagagatgtaccgcgtggaccactac
ctgggcaagcaggccgtggcccagatcctacctttccgagaccagaaccgggaggctctg
gaccccatctggaaccggcatcacgtggacagggtggagattgtcctgaaggagacggtg
gatgcggcaggccgcacgagcttttacgaggagtatggcgtgatccgtgatgtgatccag
aaccacctgactgagatcctcctgtccgtggccatagagctgccccgcaacgtcagcagc
tcggagcaggtgcttcggcacaagttgaagaccttccaagccctgcgcagcctggagaga
gccagcgccgtgctaggccagtaccaggcgtacagtgcccaggtgcgcgaggagctgcag
aagccagccagctatggcagcctgacgcccaccttcgcaggaatcctcatccacgtggac
accctgcgctgggagggtgtcccttttatcctgacgtccggcaaggccatggatgagcgg
gtggggtatgtccggatcctgttcaagaaccgggcgtactgtgcccagagcgagagccac
cgggacacgggcaagagccagtgccagcccaggcagatcatcttctacatcgggcacggg
gacctaggcagccctgcggtgctggtcagccggaacctgttcgagccccgcctgtccctg
gagagctggagggaaatgcccgagcggccggggctgcagctgttcggcctcccgttgtcg
gcctaccatgcctacggccccgtgcgggagagggacgcctactcgatcctcatctcccac
atcttccatcgccggaaggatgccttcatcacttccgagaacctgctggcctcttgggac
ttctggacacccctgttggacagtctggcccagcaggtcccacgcttgtatcccggcgga
tcggagaacggacccctgctggacttcgaagtagagggcagacaggtgtccttcgttcag
gggcagccggagcagctgattcccgggctgggctccgcccagacacccagtgacttccgc
gtcctggatgccaggtttcggcagagcccgctggtctcggcctggccggaggagctgatc
tcccgccttgcggacgacatcgaggcggcggctgaggaggcggtgcggcactccggtgag
ttccacctggccctctcaggcgggtcgagcccggtggccctgttccagaggctggccacc
cggcacttcggcttcccttgggcacacacccacctgtggctggtagacgagaggtgcgtc
ccgctcacggaccccgagtccaacttccagggcctgcaggcccacctgctgcagcacatc
cggatgccctactgcaatgtccaccccatgcctgtgcacctccaccggcggctgtgcgtg
gaggcagaccagggggtggagctctacgccaaggagatcgcagccctggtgggcaacatc
agcttcgacctggtgctgctgggtatgggggcggacgggcacacagcctccctcttcccc
cactcgcccagcggcctggatggggagcagctggtggtgctgaccgagagcccttccaag
cctcaccagcgcatgagcctcagcctgcccctcatcaaccgggccaagcaggtggccgtc
ctggtgatgggcaagaacaaacgagacatcacttcgctggtcagccgtgtgggccacgag
ccgaggaagtggcccatctcaggggtcctgcccagctccggccacttggtgtggtacatg
gactatgatgcttttctgggctga

DBGET integrated database retrieval system