KEGG   Ornithorhynchus anatinus (platypus): 100082649Help
Entry
100082649         CDS       T01045                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00190  Oxidative phosphorylation
oaa01100  Metabolic pathways
oaa04714  Thermogenesis
oaa04723  Retrograde endocannabinoid signaling
oaa04932  Non-alcoholic fatty liver disease (NAFLD)
oaa05010  Alzheimer disease
oaa05012  Parkinson disease
oaa05016  Huntington disease
Module
oaa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100082649 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100082649 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100082649 (NDUFS3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100082649 (NDUFS3)
   05012 Parkinson disease
    100082649 (NDUFS3)
   05016 Huntington disease
    100082649 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100082649 (NDUFS3)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     100082649 (NDUFS3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     100082649 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 100082649
NCBI-ProteinID: XP_007664746
Position
3
AA seq 266 aa AA seqDB search
MAAAGGLLRGGGLLRGSGLLRGGGLPRARGAVLLSTRGRTSAADKRPTVRSQDNVVHKQL
SAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLKDHTNAQFKSLADLTAVD
VPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVTVYKAANWYEREIWDMFGVFF
FNHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSP
WEAFPAYRQAADQPRLEAGDKKPEAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccggcggcctgctccggggagggggcctgctgaggggatccggcctgctg
aggggcggaggcctgccgagggcccggggtgccgtgctgctctccacccgggggaggacc
tctgcggccgacaagaggcctaccgtccgatcccaggataacgtagtccacaagcagctc
tctgctttcggcgagtacgtcgccgagattctcccaaaatacgtccagcaagttcaggta
tcttgcttcaatgagttggaaatctgtatccatcccgatggagtgatccccgtgctgacc
ttccttaaggaccatacgaatgcccagttcaaatccctggctgatttgacagcagtcgac
gtcccaacccggcagaaccgctttgagattgtctacaaccttctgtctcttcgcttcaac
tcgcggatccgggtgaagacgtacacggacgagttgactccgatcgaatcttcggtcacc
gtgtacaaggccgcgaactggtacgagagggagatctgggacatgtttggagtcttcttt
ttcaaccacccggatctgaggcggattctgaccgactacgggtttgagggccaccctttc
cggaaggacttccccctctctggctacgtggagttgcgctacgacgacgaagtgaagcga
gtggtcgcggaaccggtggagttggcccaggagttccgcaagttcgacctgaacagcccc
tgggaggctttccctgcctaccgccaggctgctgaccagcccagactcgaggccggagac
aagaagccagaagccaaatag

DBGET integrated database retrieval system