KEGG   Ornithorhynchus anatinus (platypus): 100083175Help
Entry
100083175         CDS       T01045                                 

Gene name
CPT2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00071  Fatty acid degradation
oaa01212  Fatty acid metabolism
oaa03320  PPAR signaling pathway
oaa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100083175 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100083175 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100083175 (CPT2)
Enzymes [BR:oaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100083175 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 100083175
NCBI-ProteinID: XP_028937973
Position
17
AA seq 641 aa AA seqDB search
GPGWGGGPRRQIGGAGDFLQRSPVPTLHYQQSLPRLPIPKLEDTMRRYLNAQKPLLDDSQ
FRNTEQLCKRFENGIGKELHEQLVLQDKQNKHTSYISGPWFDMYLAARDPVVLNFNPFIS
FNPDPKPEYNDQLVRATNLTVSAVRFLKTLRAGLLEPEVFHLDPARSDTDAFKRIIRWVP
PSLSWYGAYLLNAYPLDMSQYFRLFNSTRVPKPGRDELFTDETARHLLVLRRGNLYVFDV
LDRDGNAVPAAEVGARLRSVLADGSPRPEFPLAYLTGEDRDVWAGLRRELLNSGNAEALR
AVDSAVFCLCLDDSPIRDPVHLSHSMLHGDGTNRWFDKSFNLIVAADGQAAVNFEHAWGD
GVAVLRFFNEVFGDSTRAPAVSPHEPLPAPADAAVRRLDFVLNDALRAGIAKARERFDAA
TGSLTVDFVQFHKGGKGFLKKRKVSPDAVAQLAFQMAFLRQFGQTVATYESCSTAAFKHG
RTETVRPASVHTKRCSEAFVGAPAGHDVAELRALVDQCSKYHTQLTKEAAMGQGFDRHLF
ALRYLAAAKGGSLPDFYRDPAYVQINHNILSTSTLTSPAVNLGGFAPVVPDGFGIGYGVH
DDWIGCNVSSYPGRDVKAFLQCVHKSLDDIFNVLDGKPIQN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ggcccggggtggggcgggggtccgcgccgccagatcgggggagccggagacttcctgcag
cggagcccggtgcccaccctgcactaccagcagagcctgccccgcctgcctattcccaag
ctagaagacaccatgagaagatacctgaatgcccaaaagcctcttttagatgacagccaa
ttcaggaacacagagcaactttgcaaacgttttgaaaacggaatcgggaaggaattacac
gaacagctggttctccaagataagcagaacaagcatacgagttatatttcaggtccctgg
ttcgatatgtacctggcagcccgcgaccccgtcgtgctgaattttaatccgttcatatct
ttcaaccccgacccgaagcccgagtacaacgaccagctggtccgggcgacgaacctgacg
gtgtcggccgtgcgcttcctgaagacgctgcgggcgggcctcctggagccggaggtcttc
cacctcgacccggccaggagcgacacggacgccttcaagaggatcatccggtgggtgccg
ccctccctctcctggtacggcgcctacctgctcaacgcctacccgctggacatgtcgcag
tacttccggctcttcaactcgacccgcgtcccgaagccggggcgggacgagctgttcacc
gacgagacggccaggcacctcctcgtgctgaggagggggaacctctacgtcttcgacgtc
ctggaccgggacgggaacgcggtcccggccgccgaggtcggggcccgcctgcggtccgtc
ctggccgacggcagcccccggcccgagttcccgctggcctacctgaccggcgaagaccgc
gacgtctgggcggggctgaggcgggagctgctcaacagcggcaacgcggaggccctgcgg
gccgtggactcggccgtcttctgcctgtgcctggacgactcccccatccgcgacccggtc
cacctgtcccacagcatgctgcacggggacgggaccaaccgctggttcgacaagtccttc
aacctcatcgtcgccgccgacgggcaggcggccgtcaacttcgaacacgcctggggcgac
ggggtggccgtgctcaggttcttcaacgaggtgttcggggacagcacccgggcgcccgcc
gtctcgccccacgagcccctccccgccccggccgacgcggccgtgaggaggctcgacttc
gtgctcaacgacgccctgcgggccgggatcgccaaggcccgggagaggttcgacgcggcc
acgggctccctgaccgtggacttcgtccagttccacaagggggggaaggggtttctgaag
aagcgcaaggtgagtccggacgcggtggcccagctggccttccagatggccttcctccgc
cagttcggccagacggtggccacttacgagtcctgcagcacggcggccttcaagcacggc
cgcacggagaccgtgcggcccgcctccgtccacaccaagcgctgctccgaggccttcgtc
ggagcacccgccgggcacgacgtggcggagctccgggccctggtggaccagtgctccaag
taccacacccagttgaccaaggaagcggccatgggtcaagggtttgaccgacacctgttc
gcgctgcggtacttggcggcggcaaaaggcggctccttgcccgacttctaccgggatccg
gcgtacgttcagatcaaccacaacatcctgtcgaccagcacgctgaccagcccggccgtg
aacctcggagggttcgcgccggtggtgccggacggcttcggcatcggctacggcgtgcac
gacgactggatcggctgcaacgtctcctcttaccccggccgagacgtcaaggctttcctt
caatgcgtgcacaagtccttggatgacatatttaatgtcttggacgggaaacccatccaa
aattaa

DBGET integrated database retrieval system