KEGG   Ornithorhynchus anatinus (platypus): 100083239Help
Entry
100083239         CDS       T01045                                 

Gene name
PFKL
Definition
(RefSeq) phosphofructokinase, liver type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00010  Glycolysis / Gluconeogenesis
oaa00030  Pentose phosphate pathway
oaa00051  Fructose and mannose metabolism
oaa00052  Galactose metabolism
oaa01100  Metabolic pathways
oaa01200  Carbon metabolism
oaa01230  Biosynthesis of amino acids
oaa03018  RNA degradation
oaa04152  AMPK signaling pathway
oaa05230  Central carbon metabolism in cancer
Module
oaa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100083239 (PFKL)
   00030 Pentose phosphate pathway
    100083239 (PFKL)
   00051 Fructose and mannose metabolism
    100083239 (PFKL)
   00052 Galactose metabolism
    100083239 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100083239 (PFKL)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100083239 (PFKL)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100083239 (PFKL)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100083239 (PFKL)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100083239 (PFKL)
Messenger RNA biogenesis [BR:oaa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100083239 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100083239
NCBI-ProteinID: XP_001514123
Ensembl: ENSOANG00000015577
UniProt: F7DZ99
Position
7
AA seq 751 aa AA seqDB search
MNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTVIGSARC
KAFTTREGRLSAAYNLVQHGITNLCVIGGDGSLTGANIFRTEWGGLLEELVSQGKITEAV
AQKYCHLNVVGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMG
RHCGYLALVSALASGADWLFIPEAPPEDGWENHMCKRLGEMRSRGSRLNIIIIAEGAIDR
NGKPISSNYVKDLVVKRLGFDTRVTVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEATP
NTPACVVSLSGNQSVRLPLMECVQVTKEVQKAMDEKRFDEAILLRGRSFENNWNIYKLLA
HQKKALEKSNFSLAILNVGAPAAGMNAAVRSAVRIGISKGHTMYVVNDGFEGLAKGQVRE
VGWHDVAGWLGRGGSMLGTKRTLPKTCMEKIVESIRTYNIQGLLVIGGFEAYEGVLQLVE
ARGQYEELCIIMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFIV
ETMGGYCGYLATVTAIAVGADAAYIYEDPFTIHDLKANVEHLTDKMKTDIQRGLVLRNEK
CHEHYTTEFLYNLYSSEGKGIFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMSEK
LQEAYRRGRVFANSADSACVIGLKKKVVAFSPVTELKKVTDFEHRMPREQWWLNLRLMLK
MLANYQISLTEYVSGEMEHVTRRTLSIEKGF
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgcagtccgggctgtgactcgtatggggatatatgttggagcaaaagttttc
ctgatttatgagggctacgaaggcttggtggaaggaggagagaacattaaacaggcaaat
tggctgagcgtctccaatattatccagttgggaggtaccgtcattggcagtgctcggtgc
aaagcttttaccacccgagagggtcgcctgtccgccgcctataacttggtccagcatggc
atcaccaacctgtgcgtcatcggtggagatggcagtctgacgggcgccaatatcttccgc
acagaatggggtggcctgctggaggaactggtgtctcaagggaagatcacagaggcggtg
gcccagaagtactgtcacctgaacgttgttgggttggtgggctccatcgacaatgatttc
tgtggcacggatatgaccattggcactgactcagccctgcaccggatcatggaggtgatt
gatgccatcaccaccacagctcagagccatcagaggacatttgtgctggaagttatgggc
aggcactgtgggtacctggccttggtctcagccttggcatctggagctgactggctcttc
atccctgaggctccgccggaggacggctgggagaatcacatgtgcaagagacttggggag
atgcgtagcagagggtccagactcaatatcatcatcattgctgaaggtgccatcgataga
aatggaaaacccatctcatccaattacgtaaaggatctggttgttaagcgccttggattt
gatactcgggtgacggtcctgggccacgtacagcgaggaggaacgccctctgcttttgat
cgggtcttgagcagtaaaatggggatggaggccgtgatggcgttactggaagccacgccc
aacacaccagcctgtgtcgtgagtctgtctgggaaccagtctgtccgactgcccctgatg
gagtgcgttcaggtgacaaaagaagtgcagaaagccatggatgagaaaaggtttgatgaa
gcgatccttctccgagggaggagttttgaaaataactggaacatttacaagctccttgcg
caccagaagaaagcgctggaaaagtccaacttctccttagcaattttgaacgtcggggca
ccagcagccgggatgaatgcggcagtgaggtcagcggtgaggatcggaatctcgaagggg
cacacgatgtacgtcgtcaacgacggcttcgagggcttagccaaggggcaggtccgagag
gtgggctggcatgacgtagccggctggctgggccgcgggggatcgatgctgggaaccaag
agaaccctcccgaagacatgcatggagaaaattgtggaaagcattcggacttacaacatc
cagggtctgttggtcatcggggggtttgaggcgtatgagggcgtgctgcagctggtcgag
gcccgagggcagtacgaggaactgtgcatcatcatgtgcgtcatcccggccaccatcagc
aacaacgtccccggcaccgacttcagcctcggctcggacaccgccgtcaacgccgccatg
gagagctgcgaccggatcaagcagtcggcctccgggaccaagcgccgggtgttcatcgtg
gagacgatgggcgggtactgcggctacctggccacggtgacggccatcgccgtcggagca
gacgccgcttatatctacgaagatcctttcaccatccacgacttaaaggcaaatgtggag
cacttgaccgacaaaatgaaaacagacattcagagaggcctggtgctccgaaatgaaaag
tgtcacgaacattacacgacagaattcttgtacaatctgtactcatccgaggggaaaggg
attttcgactgtaggaccaacgtcttgggccatctgcagcagggaggagctcccaccccg
ttcgaccgtaactacggcaccaagttgggagtgaaggctatgctgtggatgtcggaaaaa
ctgcaggaggcctaccgcaggggtcgcgtgttcgccaattcggcagactcggcctgcgtg
attggcctgaagaagaaagtggtggccttcagccccgtgaccgaactcaagaaagtcacc
gatttcgaacacaggatgccccgggagcagtggtggctaaatctgcgcctgatgctgaag
atgctggccaactatcagatcagcctgaccgagtacgtctccggggagatggagcacgtc
acccgacgcaccctcagcatcgagaagggcttctaa

DBGET integrated database retrieval system