KEGG   Ornithorhynchus anatinus (platypus): 100083570
Entry
100083570         CDS       T01045                                 

Gene name
AHRR
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oaa03000]
    100083570 (AHRR)
Transcription factors [BR:oaa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100083570 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9
Other DBs
NCBI-GeneID: 100083570
NCBI-ProteinID: XP_028909375
Position
X2
AA seq 719 aa
MIPPGECMYAGRKRRKPIQKQKPTSGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIIAK
LDKLSVLRLSVSYLRVKSFFQAIPEKHWRKPDDPIKGHHLSSESALPEGGLLLESLNGFA
LVVSAEGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQLAFG
SPLQTETGEDCILSKLLKAQECNSTPTEYSVFLTRCFICRVRCLLDSTSGFLTMQFQGKL
KFLFGQKKKTPSGALLPPRLSLFCIVVPILLPSVAEMKMKSVLLRAKHRADAAAPTDPKA
KALAGLCESEFHGRTNFQGAKNSGENGISLFKIKSNEDEWLWVQANGQRFYRSGCSDCAV
APQPTANLRAREEGEPLPPSHSTSGMPGRREMPPQPSGSVETLGQMEHLHWATEMGSQDG
VRRKLKPNKTEKCLGQEGPFGAWVSLSGVQGIHHSNSISAFRSATHSPPMGPHGYAFPSR
IIRPSPGGEQNPLNPRSHHGPSETFQSCSGFQHFAMGGYAAENVKSQNTEAICEPLLPLD
MPIKLENDSDSDHGADCFAISQNHGWLGEKRQLTSLPPRMHFKTELDACEHLVPCDNPKH
YIYPPFGGQCAVSPQPHHRAISGAGKEMATLYPPNCAYWEPPHSLQDPEYLSQLYPPGSA
STRAQRNHLSSRLPGEPRAPGAVQMIKREPLDSPPWVGRGHVSVQGTMPPKATGRLFFQ
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgattccaccgggggagtgtatgtatgctggaaggaaaagaagaaaacctatacaaaaa
caaaagccaacatcgggaaacgaaaagtccaacccttcaaagaggcacagagatcgtctg
aacgcggaattggaccatttggcaagcctcctgcctttcccgccggacatcattgccaaa
ctggacaagctctcagtcttgcgcctcagtgtcagctacctcagggtgaaaagcttcttc
caagctatcccggagaagcattggaggaagccagatgacccgatcaaaggacatcatcta
tccagtgagtctgccctgccggaagggggattgttgctagagtctttaaatggttttgct
ctggtggtgagtgccgaaggaatgatattttatgcatcatcaactattgtggactatctg
ggctttcatcagacggatgtaatgcaccagaacatatacgattacatccatgtggatgac
cgtcaagatttctgcagacagcttcactgggccatgaatcccccacagctggcatttggc
agcccacttcagacagaaacaggagaagactgtattctcagtaagctgctcaaggcccag
gagtgtaacagcacgccaacggagtactcggtgtttctaacccgctgtttcatctgtcgg
gtccgctgcctcctggacagcacctctggcttcctgacaatgcagtttcaaggtaaactc
aagtttctgttcgggcaaaagaagaagacaccatctggagcactgctacccccaaggctc
tccttgttttgcatcgtggtgccaattcttctcccttcggtggcggagatgaagatgaaa
agtgtgctcttgagagcgaagcatagagccgatgcagcagccccgacagaccccaaagca
aaggctttggcgggtctgtgtgaatcggagtttcatgggagaaccaatttccaaggagct
aagaatagtggcgaaaatggcatctctctgttcaaaatcaagtcaaatgaagatgagtgg
ctctgggtccaagccaacggccagcgcttttacaggagtggctgctctgactgtgctgtc
gctcctcagccaactgccaacctccgtgccagggaggagggggagccccttcccccatct
cacagcacctctggaatgccaggccgaagggaaatgccgccgcagcccagtggctccgtg
gagaccctgggacagatggaacacctgcactgggcgacagaaatgggcagtcaggatgga
gtcaggcggaaactcaaaccaaataagacggagaagtgtttggggcaggagggaccattc
ggggcttgggtgtccctttcaggagtccaaggcattcaccactctaacagcatctcagct
ttccgaagtgccacccactctccaccgatgggtccgcacggctacgcttttcccagccga
ataatcagaccttcccccggcggagagcaaaatccactgaacccccgttcccaccacggg
ccctcggagaccttccagtcctgttcgggtttccagcattttgccatggggggctacgct
gccgaaaacgtcaaatcgcaaaatacggaggccatctgcgaaccgttgttgcccctcgat
atgcccatcaaattggaaaacgattccgattcagatcatggagcagactgctttgcaatt
tcacaaaaccacgggtggttgggagagaaaaggcagctaaccagcctccctcctaggatg
cactttaaaaccgaactggatgcctgcgagcacctggttccctgtgacaacccgaagcat
tacatctaccctcctttcggtgggcagtgtgcagtgagccctcagccccaccatcgagcc
atcagtggagcagggaaggagatggcaaccttgtacccgccaaactgtgcctactgggag
ccgccacacagccttcaggacccagagtatctcagccagttgtaccctcccggttccgct
agcacaagggcgcagaggaatcacctgtcttccaggctgccgggggagcctcgggcccca
ggagcggtccagatgattaagcgggagcccttggattccccaccgtgggtgggccggggc
cacgtgagcgtccaagggacaatgcctccgaaagccactggtcgtctgttcttccagtag

DBGET integrated database retrieval system