KEGG   Ornithorhynchus anatinus (platypus): 100083809Help
Entry
100083809         CDS       T01045                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00562  Inositol phosphate metabolism
oaa01100  Metabolic pathways
oaa04020  Calcium signaling pathway
oaa04070  Phosphatidylinositol signaling system
oaa04919  Thyroid hormone signaling pathway
oaa04933  AGE-RAGE signaling pathway in diabetic complications
Module
oaa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100083809 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100083809 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100083809 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100083809 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100083809 (PLCD1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100083809 (PLCD1)
Membrane trafficking [BR:oaa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100083809 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100083809 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 TEP1_N
Motif
Other DBs
NCBI-GeneID: 100083809
NCBI-ProteinID: XP_007657073
Position
Un
AA seq 596 aa AA seqDB search
MSFKEVKNFLKEINVQVDDSYARWIFKECDKSNTDSLEDNEIEEFYKMLTKRPEIDEIFQ
SIAGSADTLSVDRLVQFLRLEQKEDADPKMAHSLIERYEPSETAKEAKEMTKDGFLMYLL
SADGNVFNLAHKKVYQDMTQPLCHYLVSSSHNTYLMEDQLTGPSSTEAYIRALSRGCRCV
ELDCWDGSGNEPVIYHGYTFTSKILFCDAIQAIKNYAFKASPYPVILSLENHCSLEQQRV
LARHMERILGDLLVVAPVDGMVNNFPSPEQLKGKILLKGKKLNGLLDGPEAAGTDAAYVS
DEDEAAEMEDESVKSKLKEKNSESLKLAKELSDLVTYCKSVHFEGFEGSARDRPFYEMSS
LSENKALRLVHEEGTSFIRHNAKYLSRIYPAGRRTDSSNYCPVGLWNVGCQIVALNFQTP
GSEMDVYQGRFQDNGFSGYVLKPAFLRDPASRFDPRDPSMEGPWWAPKKLSILVISGQQL
PKVNKSKNSIVDPKVTVEVLGTPKDSTSQQTPMVGNNGFNPQWNWDLQFNVTVPELALVR
FVVDDYDISSKNDFVGQCTVPFTSLKMGYRHIHLLSKNGDQYPSATLFVKIQIQDN
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaagaggtcaagaactttctgaaggagattaacgtgcaggtggatgacagc
tatgcaaggtggatctttaaggagtgcgacaagtccaacacagactccctggaggataac
gagatagaggagttttacaagatgctgaccaagcgaccagaaatcgatgaaatcttccag
tccatcgcgggctctgccgacactctgtcagtggaccggttggtgcagttcctgaggttg
gagcagaaggaggacgcagaccctaagatggctcactctctcatcgagcgatatgagccc
agcgagacagccaaggaggcgaaggaaatgacaaaggacgggttcctcatgtacctgctc
tccgcggacggcaacgtcttcaacctggcccacaagaaagtgtaccaagacatgacccag
cctctctgccactacctggtgtcatcctcgcacaacacctacctcatggaagaccagctg
accgggcccagcagcaccgaggcctacatccgggctctgtcccggggctgccgctgcgtg
gagctggactgctgggacggctccggcaacgaacctgtcatctaccacggctacacattc
acctccaagatcctcttctgcgatgccatccaggccatcaagaactatgccttcaaggct
tccccgtatccggtgatcctgtccctggagaatcactgcagcctggagcagcagcgagtc
ttggcccggcacatggagagaatcttgggggatcttctggtggtggcgccagtcgacggg
atggtcaacaactttccatctcccgagcagctgaaggggaagatcctgctgaaagggaag
aagctgaatggtttgctggacggccccgaggccgcgggcaccgatgccgcctacgtctca
gacgaggacgaagctgctgagatggaagacgaatctgtgaagagcaaattgaaagagaag
aactcggaatcgctaaagctggccaaggagctgtcggatctggtcacctactgcaagagc
gtccacttcgagggtttcgaagggtccgcgcgggaccggcccttctacgagatgtcgtcg
ctctcggagaacaaggccctgcggctggtgcacgaagaagggaccagtttcatccgccac
aacgccaagtatctgagtagaatctacccggccggccggcggaccgactcttccaactat
tgccccgtcggcctgtggaacgtcggctgtcagattgtggctctgaatttccagactccg
ggctcagagatggatgtgtaccagggccggtttcaagacaatggattctccggctacgtc
ctcaagccggccttcctgcgagaccccgcgtcccgcttcgaccccagagaccccagcatg
gagggcccctggtgggctcccaagaagctttccatcttggtgatctcgggacagcagctg
cctaaggtgaacaagagcaaaaactccattgtggacccgaaggtgacggtggaggtgctc
gggacgcccaaggacagcaccagccagcagacccccatggtggggaacaacggcttcaat
ccccaatggaactgggacctccagttcaacgtgacagtccccgagctcgccctggttcgt
ttcgtggtggatgactacgacatctcgtccaagaatgactttgtgggccagtgcactgtc
cccttcaccagcctcaaaatgggctaccgccacatccacctgctgtccaagaacggagac
cagtacccatctgccaccctcttcgtgaagatccagatccaggacaactag

DBGET integrated database retrieval system