KEGG   Ornithorhynchus anatinus (platypus): 100084333Help
Entry
100084333         CDS       T01045                                 

Gene name
PUDP
Definition
(RefSeq) pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oaa01009]
    100084333 (PUDP)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     100084333 (PUDP)
Protein phosphatases and associated proteins [BR:oaa01009]
 HAD phosphatases
  Other HAD phosphatases
   100084333 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-GeneID: 100084333
NCBI-ProteinID: XP_028935621
Position
15
AA seq 226 aa AA seqDB search
MAPGTRTHLLFDMDGLLLDTERLYSEVFQEICDRFGKKYTWDVKSLVMGKKAQDAAEIII
DALELPMTKEELLKESKLKQEKLFPTAALMPGVEKLIRHLHSHQIPMAVATSSARVTFEM
KSSRHKEFFSLFHHIVLGDDPEVKNGKPHPDVFQVCARRFNPPPLPEKCLVFEDAPYGVE
AALAAGMQVVMIPDENLNQDLTRKATLVLKSMLDFKPELFGLPPYD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccccggaacccgcacccacctgctcttcgacatggacggcctcctgctcgatacc
gagcgactgtactcagaggtgttccaggaaatctgcgatcgcttcgggaagaaatatacc
tgggacgttaaatccctcgttatgggtaaaaaagcacaagacgctgcagagattatcatc
gatgccttagagctcccgatgaccaaagaagaactgctgaaggaaagtaaactcaagcaa
gagaaactatttcctactgctgccttgatgccaggtgtggagaaattgatccgccatctg
cacagccatcagatccccatggctgtggccaccagctcagctcgggtgacatttgaaatg
aagtcgagcaggcacaaggagttctttagccttttccaccacatcgtgttgggagacgat
ccggaagtcaagaatggcaaacctcatcctgatgtgtttcaggtgtgtgcgaggagattc
aacccccctccgcttccagaaaagtgtcttgtttttgaagatgctccctacggtgtggag
gcagcactggcggctggaatgcaggtggttatgattccggatgaaaatctaaatcaagac
ctcacgagaaaggcgacgctggtgctgaaatcgatgctagacttcaagccggaattgttt
gggctaccgccctatgattaa

DBGET integrated database retrieval system