KEGG   Ornithorhynchus anatinus (platypus): 100084365
Entry
100084365         CDS       T01045                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X2
  KO
K04462  ecotropic virus integration site 1 protein
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa05200  Pathways in cancer
oaa05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100084365 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100084365 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100084365 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oaa03000]
    100084365 (MECOM)
Transcription factors [BR:oaa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100084365 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_11 zf-BED Zn-ribbon_8 zf-C2H2_8 zf-met PyrI_C
Other DBs
NCBI-GeneID: 100084365
NCBI-ProteinID: XP_007660172
Position
1
AA seq 1212 aa
MSEADGEVSTFSSLKLQEPSSPATSNEEFTVKDGSPYKAPIYIPDDIPIPPEFELRESNV
PGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDPSCGWEVLDEFCNVKFCLDASQPDVGSW
LKYIKFAGCYDRHNLVACQINDQIFYRVVADIVPGEELLLFMKSEEYSHEAMAPDIHEER
QYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQQKLESENDLREMHEIQECKE
CDQVFPDLPSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKV
FTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQ
FSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPG
TPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIP
ASSPVKGLPSTEQTNKSQSPLMTHPQILPATQDILKALNKHPPVGENKPVELQPERSSEE
RPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKFKENGKMFKDKVNSLQ
NLASINNKKEYNNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVG
ALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKMEPQSPSEVKKIQKGSSESPFDLTTK
RKEEKPIPPAASKSAAPPGTSQDQPLDLSMGSRSRASGTKQAEPRKNHVFGEKKGGDLEQ
RKASDASLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQMPDQRT
WMSAIENMAEKLESFSALKPEANELIQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCG
KIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCF
GQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSNHGNQ
SPRKTDERMNGSHFKDDKVLVASQNSDLLDDEEVEDEVMLDEEDEESDVTGKPAKEPVIS
NIHEGNHEDDYEETSALEMNCKISPGRYKEEEYKTGLSALDHIRHFTDSLKMRKMEENQY
NEAELASFSTSHLPEDLKQPLFRKSKSQAYAMMLSLSDKDSLHSTSHNSPNTWHSMARAA
AESSAIQSISHV
NT seq 3639 nt   +upstreamnt  +downstreamnt
atgtcagaagctgatggagaggtgagcactttctcctctctcaaacttcaagaaccttct
tctccagccacatcgaatgaagaattcaccgtgaaggatgggtctccttataaagccccc
atttacattcccgatgacattcccattcctcccgagtttgaactccgagagtcaaacgtt
ccaggggctggattaggaatatggaccaaaaggaagatcgaggcaggcgagaagtttggg
ccgtacgtcggagagcagcgatccaatctgaaagatcccagctgtggatgggaggtcttg
gatgagttttgcaatgtgaaattctgcttagatgccagtcaaccagatgtaggcagctgg
ctcaagtacatcaagtttgctgggtgctatgatcgacacaatcttgtggcgtgccagata
aatgaccagatattctacagagtggtagcagacattgtgccaggggaggagctcttactg
ttcatgaagagtgaagaatattcacatgaagcaatggctcctgatattcatgaagaacgc
cagtatcgctgtgaggattgtgatcagctgtttgaatctaaagctgaactagtggatcac
cagaaatttccatgcagcacgccacactcagcattttccatggtagaagaggattttcag
caaaaactcgaaagtgagaacgatctccgggagatgcatgaaatccaggaatgtaaagag
tgtgatcaagtctttccagatttaccaagcttggagaaacacatgctgtcacattccgaa
gagagagaatacaagtgtgatcagtgtcccaaagcttttaactggaagtccaacttaatt
cgtcaccagatgtcacatgacagtggaaagcactacgaatgtgaaaactgtgccaaggtt
ttcacggatcctagcaacctgcagaggcacattcgctcccagcatgttggggctcgggct
catgcttgccccgagtgtggcaaaacttttgccacttcatcaggcctcaaacaacacaag
cacatccacagcagtgtcaagccttttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacttccatggttaatatgaatcatgccaatccgggccttgct
gactattttggtgccaataggcatcctgctggtcttacctttccaacagctcctggattc
tcttttagctttcccggtctgtttccttccggcttgtaccacaggccacctttgatacct
gctagttctcctgttaaaggactaccgagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcaaatactgccagctacccaggatattttgaaggcactaaataag
cacccacctgtaggggaaaataagccagtggagcttcaacctgagcggtcctctgaagag
aggccccttgaaaaaatcagtgaccagtcagagagtagtgaccttgacgatgtcagtacc
ccaagtggcagtgacctggaaaccacctctggctctgatctggaaagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaaactctcttcag
aatttggcttcaataaataataagaaagaatacaacaatcattccattttctcaccatct
ttagaggaacaaactgcggtgtcaggagcggtgaatgattctataaaggctattgcttct
attgctgaaaaatactttgggtcaacaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tacccatttcctgatagagacttgagaccgttacctttgaaaatggaaccccaatcacca
agtgaagtcaagaaaatccagaagggaagctctgagtctccctttgacctcaccactaaa
cgaaaggaggagaagccaattcctcccgcggcctcaaaatccgcggctcctcctggcacg
agccaagaccagcccctagatctcagcatgggcagccgaagccgagccagtggtacaaaa
caggctgagcctcggaagaatcacgtttttggtgaaaagaaaggaggcgatcttgaacaa
aggaaagcgtctgatgcctccctgcagcatgccagacccactcctttctttatggaccct
atttacagggtggagaaaagaaagctaaccgacccacttgaagctttaaaagaaaaatac
ttgagaccttcgccaggattcttgtttcacccacaattccaaatgcctgatcagagaact
tggatgtcagctattgaaaacatggcagaaaaactcgagagctttagtgccctgaaacca
gaagccaatgaacttattcagtctgttccttccatgttcaacttcagagctcctcctaat
gccctcccagagaatctcctgagaaagggcaaggaacgttatacttgcagatactgcggc
aagatttttccaagatctgcaaacctaacacgccatttgagaacacatacaggggaacag
ccttatagatgcaagtactgtgacagatcgtttagcatatcttccaacctgcagcggcac
gttcgtaacatccacaataaagaaaagcccttcaagtgtcacttatgtgacaggtgtttt
ggtcaacaaaccaacctagacagacatctgaaaaaacatgaaaatgggaatatgtctggt
actgccacatcatccccgcattctgaactggaaagcacaggtgcaatcctggatgacaaa
gaggattcttatttcacagaaattcggaatttcattggtaacagtaaccacggtaatcaa
tcacccaggaaaacagatgagagaatgaacggtagccattttaaggatgacaaagttttg
gtggccagtcaaaattccgaccttctggacgatgaagaagttgaagatgaggtgatgttg
gatgaagaagatgaagaaagtgatgttacaggaaaacccgccaaggagccggtcataagt
aatatacatgaagggaaccatgaggatgactatgaagaaacaagtgctctggaaatgaac
tgcaagatctcccctggcaggtataaagaggaggagtataaaactggactttctgctttg
gaccatataaggcacttcacagatagcctcaaaatgaggaaaatggaagagaatcaatat
aacgaagctgaactggcttcttttagtacgtcccacctgccggaggacctaaaacagccg
ttattcagaaagtccaagtcacaggcctacgctatgatgttgtcactctctgacaaggac
tccctccattcgacatctcacaattctcccaatacgtggcacagtatggcaagagctgct
gcagaatccagcgctatccagtccattagccatgtatga

DBGET integrated database retrieval system