KEGG   Ornithorhynchus anatinus (platypus): 100085065Help
Entry
100085065         CDS       T01045                                 

Definition
(RefSeq) aldo-keto reductase family 1 member C1 homolog isoform X2
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00140  Steroid hormone biosynthesis
oaa00590  Arachidonic acid metabolism
oaa00790  Folate biosynthesis
oaa01100  Metabolic pathways
oaa04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100085065
   00590 Arachidonic acid metabolism
    100085065
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100085065
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100085065
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     100085065
    1.1.1.188  prostaglandin-F synthase
     100085065
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     100085065
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     100085065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 100085065
NCBI-ProteinID: XP_001511338
UniProt: F7C0F4
Position
13
AA seq 324 aa AA seqDB search
MDLTQAHSVKLSDGNIMPVLGLGTSTKKEVPKSEAGKATRMAIDAGFRHIDGAYLYGNEV
EVGQAIRAKIADGTVTRKDIFYTSKLWCTFHPPQLVRKALEISLRRLQLDYVDLYIIHGP
FSLKPGEDLFPRDGNGKIIFDSVDLCATWEALEACKDAGLVKSIGVSNFNRKQLEMILNK
PGLKYKPVCNQVECHPYLNQSKLLEFCKAKDIAFVVYSALGSQRDKNWVDQSTPVLLEDP
VLGAIAKKHNRTPALVALRYQLQRGAVVLVKSFNEKRIKENMQVFDFQLTPEDMKTIDGL
SRNVRYREFLPFSTHPNYPFNEEY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacctcacccaggcccacagcgtgaagctcagcgatgggaacatcatgcctgttctg
ggattaggcacctctactaaaaaagaggtccccaaaagtgaggctggaaaagccaccagg
atggccattgatgctggcttccgccacatcgatggcgcatatctctatgggaatgaagtg
gaggtcggacaggccattcgagcgaagattgcagatggcacagtgaccagaaaagacatt
ttctacacttcgaagctctggtgcaccttccatccccctcaactggtccggaaagccctg
gaaatatcactgaggaggctccagctagactacgtggatctctatatcattcacggcccc
ttctctctcaagcctggagaggacttgtttcccagggatggaaatggaaaaatcattttc
gacagtgtggatctctgcgccacttgggaggccctggaggcgtgcaaagatgcaggcttg
gtcaagtccatcggcgtctccaacttcaaccgcaagcagctggagatgatcctgaacaaa
cccgggctcaaatacaagccggtctgcaaccaggtggagtgtcacccgtaccttaaccag
agcaaactgctggagttctgcaaggccaaagacatcgccttcgtggtgtacagtgccctg
ggctcccagcgagataagaactgggtggatcagagcaccccagtgctgctggaggaccca
gtcctgggtgccatcgccaagaagcacaaccgcaccccggctctggtcgccctgcgctac
cagctgcagcgtggggctgtggtcctggtcaagagcttcaacgagaagcggatcaaagag
aacatgcaggtctttgatttccagctgactccagaggatatgaaaaccatcgacggcctc
agcagaaatgtccgctacagagaattcttacctttctcgacccaccctaactacccattt
aatgaagaatactga

DBGET integrated database retrieval system