KEGG   Ornithorhynchus anatinus (platypus): 100087105
Entry
100087105         CDS       T01045                                 

Symbol
CASP3
Name
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01524  Platinum drug resistance
oaa04010  MAPK signaling pathway
oaa04115  p53 signaling pathway
oaa04210  Apoptosis
oaa04215  Apoptosis - multiple species
oaa04650  Natural killer cell mediated cytotoxicity
oaa04657  IL-17 signaling pathway
oaa04668  TNF signaling pathway
oaa04726  Serotonergic synapse
oaa04932  Non-alcoholic fatty liver disease
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa04936  Alcoholic liver disease
oaa05010  Alzheimer disease
oaa05012  Parkinson disease
oaa05014  Amyotrophic lateral sclerosis
oaa05016  Huntington disease
oaa05020  Prion disease
oaa05022  Pathways of neurodegeneration - multiple diseases
oaa05132  Salmonella infection
oaa05133  Pertussis
oaa05134  Legionellosis
oaa05145  Toxoplasmosis
oaa05146  Amoebiasis
oaa05152  Tuberculosis
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05162  Measles
oaa05163  Human cytomegalovirus infection
oaa05164  Influenza A
oaa05165  Human papillomavirus infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05168  Herpes simplex virus 1 infection
oaa05169  Epstein-Barr virus infection
oaa05170  Human immunodeficiency virus 1 infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05210  Colorectal cancer
oaa05222  Small cell lung cancer
oaa05416  Viral myocarditis
oaa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100087105 (CASP3)
   04668 TNF signaling pathway
    100087105 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100087105 (CASP3)
   04215 Apoptosis - multiple species
    100087105 (CASP3)
   04115 p53 signaling pathway
    100087105 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100087105 (CASP3)
   04657 IL-17 signaling pathway
    100087105 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    100087105 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100087105 (CASP3)
   05206 MicroRNAs in cancer
    100087105 (CASP3)
   05205 Proteoglycans in cancer
    100087105 (CASP3)
   05203 Viral carcinogenesis
    100087105 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100087105 (CASP3)
   05222 Small cell lung cancer
    100087105 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100087105 (CASP3)
   05161 Hepatitis B
    100087105 (CASP3)
   05160 Hepatitis C
    100087105 (CASP3)
   05164 Influenza A
    100087105 (CASP3)
   05162 Measles
    100087105 (CASP3)
   05168 Herpes simplex virus 1 infection
    100087105 (CASP3)
   05163 Human cytomegalovirus infection
    100087105 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100087105 (CASP3)
   05169 Epstein-Barr virus infection
    100087105 (CASP3)
   05165 Human papillomavirus infection
    100087105 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100087105 (CASP3)
   05133 Pertussis
    100087105 (CASP3)
   05134 Legionellosis
    100087105 (CASP3)
   05152 Tuberculosis
    100087105 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100087105 (CASP3)
   05145 Toxoplasmosis
    100087105 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100087105 (CASP3)
   05012 Parkinson disease
    100087105 (CASP3)
   05014 Amyotrophic lateral sclerosis
    100087105 (CASP3)
   05016 Huntington disease
    100087105 (CASP3)
   05020 Prion disease
    100087105 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    100087105 (CASP3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100087105 (CASP3)
   05416 Viral myocarditis
    100087105 (CASP3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100087105 (CASP3)
   04932 Non-alcoholic fatty liver disease
    100087105 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100087105 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100087105 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oaa01002]
    100087105 (CASP3)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100087105 (CASP3)
Peptidases and inhibitors [BR:oaa01002]
 Cysteine peptidases
  Family C14: caspase family
   100087105 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 100087105
NCBI-ProteinID: XP_028932478
Ensembl: ENSOANG00000039253
Position
12:1665110..1686949
AA seq 285 aa
MAAPQVEGGAASGEVMVDSKSFHSSQGKVPGKQFLGSSASLDDRYRMDYPNMGICLIINN
KNFHPDTRMGCRSGTDVDAASLRDTFKKLKYEVRCKNDLKRREILELLTSVAHEDHSKRS
SFVCVLLSHGEEGVIFGTDGSLELKSLASLFRGDNCRSLVGKPKLFIVQACRGTELDSGV
EADSSSADDGSEQKIPVEADFLYAYSTAPGYYSWRNSMNGSWFIQALCAMLKQHAHTLEL
LHILTRVNRKVATEFESYSLDATFNAKKQIPCIVSMLTKELYFPY
NT seq 858 nt   +upstreamnt  +downstreamnt
atggcggccccccaggtggagggaggagcggcgtcgggcgaggtgatggtcgactcaaaa
tccttccacagctcacaggggaaggtgcccgggaagcagttcctggggtcctcagcctcg
ctggacgacaggtacaggatggattacccaaacatggggatatgtttaatcatcaacaac
aagaacttccacccagacacaagaatgggctgtcggtccggcacagacgtggacgccgcc
agcctcagagacactttcaagaagctgaaatacgaagtcaggtgtaaaaacgacctgaaa
aggcgtgagattctggagttactcacctccgttgcccacgaggaccacagcaagaggagc
agttttgtgtgtgtgctgctaagccacggggaagaaggagtgattttcgggaccgacggc
tctctggagctgaagagcttagcgagcctcttccgaggggacaactgccgaagtctggtg
gggaagcccaaactcttcatcgtccaggcctgtcggggcaccgagttggacagcggcgtc
gaggcggacagctccagcgcagacgacggatcggagcagaaaatccccgtcgaggccgac
ttcctgtacgcgtattctacggcccccggctactattcttggcgtaactccatgaacggc
tcctggttcatccaggcgctgtgcgcgatgctcaagcaacacgctcacaccctggagctc
ctccacatcctcacccgcgtgaaccggaaggtggccaccgagttcgagtcgtattccctg
gacgccacgttcaacgcaaagaagcagattccgtgcatcgtgtccatgctcaccaaggag
ctctactttccttactga

DBGET integrated database retrieval system