KEGG   Ornithorhynchus anatinus (platypus): 100087310Help
Entry
100087310         CDS       T01045                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04260  Cardiac muscle contraction
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04921  Oxytocin signaling pathway
oaa05410  Hypertrophic cardiomyopathy (HCM)
oaa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
oaa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100087310 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100087310 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100087310 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    100087310 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100087310 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100087310 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    100087310 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oaa04040]
    100087310 (CACNG7)
Ion channels [BR:oaa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100087310 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 Amastin L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 100087310
NCBI-ProteinID: XP_028930146
Position
10
AA seq 275 aa AA seqDB search
MSNCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWHRG
RSPSDISSDVSIQMTQNYPPAIKYPDHIHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactgcagcagccgggcgctgaccctgctgagcagcgtgttcggggcctgcggg
ctgctcctggtgggcatcgccgtcagcacggactactggctctacatggaggagggcacc
gtcctgccccagaaccagaccaccgaagtcaagatggccttgcacgccgggctctggcgg
gtctgcttcttcgcaggccgggagaaaggccgctgtgtcgcctccgagtatttcctggag
cccgagatcaacttggtgacagagaatacggagaacattctgaagacggtgcggaccgcc
acccccttccccatggtcagcctcttcctcgtctttacggccttcgtcatcagcaacata
ggtcacatccgccctcagaggaccatcctggccttcgtctccggcatcttcttcatcctc
tcgggtctctctctggttgttggcctggtgctctacatctctagcatcaacgacgaggtc
atgaaccggcccagcagctctgagcagtatttccactatcgctacggttggtcctttgcc
tttgcggcctcctcgttccttctcaaagagggcgccggagtgatgtcagtgtacctgttc
acgaagcgctacgctgaggaagagatgtaccggccgcacccggccttctaccggccccgc
ctcagcgattgttctgactactctggccagttcctgcagcccgaggcctggcaccgcggc
cgcagcccctcggacatatcctccgacgtctccatccagatgacccagaactacccaccg
gccatcaagtatcctgaccacatccacatctccacctccccctgctag

DBGET integrated database retrieval system