KEGG   Ornithorhynchus anatinus (platypus): 100087666Help
Entry
100087666         CDS       T01045                                 

Gene name
NPR2
Definition
(RefSeq) atrial natriuretic peptide receptor 2 isoform X1
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00230  Purine metabolism
oaa01100  Metabolic pathways
oaa04022  cGMP-PKG signaling pathway
oaa04270  Vascular smooth muscle contraction
oaa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100087666 (NPR2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100087666 (NPR2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100087666 (NPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100087666 (NPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oaa01001]
    100087666 (NPR2)
Enzymes [BR:oaa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100087666 (NPR2)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100087666 (NPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA
Motif
Other DBs
NCBI-GeneID: 100087666
NCBI-ProteinID: XP_028916506
Position
3
AA seq 1083 aa AA seqDB search
MALTPRLPPLLLPLLVVVVGGGRPPGTRNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEA
LGRALPVDLRFISSELDGACSEYSAPLGAVDLKLYHDPDLLLGPGCVYPAASVARFASHW
RLPLLTAGAVASGFTAKSEHYRTLVRTGPSAPKLGEFVVMLHGHFNWSARAALLYLDART
DDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHE
ILLQAQRENLTNGDYVFFYLDVFGESLRASPTRPPGRPWQDNRTWEQAQALREAFQTVLV
ITYREPPNPEYQEFQRRLLLRARTDFGVELTPSLMNLIAGCFYDGILLYAEVLNETLQEG
GTREDGLRIVEKMQGRRYQGVTGVVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAE
KQIWWTGQPIPWVKGAPPSDNPPCAFDLDDPSCDKTPFSTLAIVALGTGLTFIMFGVSSF
LIFRKLMLEKELASMLWRIRWEELQFGNAERYHKSAGSRITLSLRGSSYGSLMTAHGKYQ
IFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIV
TEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIGHHGSLKSSNCVVDSR
FVLKITDYGLASFRSAGEPEDSHALYAKKLWTAPELLCPGRLPTMGMQKGDVYSFGIILQ
EIALRNGPFYVEGMDLSPKEIVQKVRHGQRPYFRPSIDRGQLSEELAMLMERCWAQDPAE
RPDFSQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLY
QILPHSVAEQLKRGETVRAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDA
IIDNFDVYKVETIGDAYMVVSGLPGRNGKRHAPEIARMALALLEAVASFRIRHRPNDQLR
LRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQDCHFADVFDSCLIYKHLRVC
PHPEAAPSPDHLGYSSLSLRQLSYVLPKMRRPDCTQSSRSSPSLLPPSCPEDPCLLHHQR
CLG
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaccccacggctgccgccgctgctgctgcccttgctggtcgtggtggttggg
ggagggcggccccctgggacccggaatctgaccctggcagtggtcctgcccgagcacaac
ctgagttacgcctgggcctggccccgggtgggcccggcggtggctctggcggtggaggcc
ctgggccgcgcgctgccggtggacctgcgctttatcagctccgaactggacggggcctgt
tccgaatactcggccccactgggtgccgtggacctgaaactgtaccacgaccccgatctg
ctgctgggccccggctgcgtttacccggccgcctcggtcgcacgctttgcgtctcactgg
cggctgccgctgctgaccgccggagccgtggcctctggcttcacggccaagagcgaacac
taccgcacgctggttcgcaccggaccctcggcccccaaactgggggaatttgtggtgatg
ctgcatggacacttcaactggagtgcccgggctgccctgctctacctggacgcccgcact
gacgatcgacctcactacttcaccatcgagggggtcttcgaggccctgcagggcagcaac
ctcagcgtgcagcaccaggtgtatgcccgagagccaggtggccctgagcaggccacccac
ttcatccgggccaacgggcgcatcgtgtacatctgcgggcccttggagatgctgcatgag
atcctgctccaggctcagagagagaacctgaccaatggagactacgtcttcttctacttg
gatgttttcggggagagcctgcgggccagtcccactcgcccccctggccggccttggcag
gacaatcgtacctgggagcaggcccaagccctgagagaagccttccagacggtgttggtg
atcacgtaccgagaacccccgaacccggagtaccaggagttccagcgccgcctactgcta
cgggcccggactgactttggtgtggagctcaccccttccctgatgaacctgattgcgggc
tgcttctacgatgggatcctgctctacgcggaggtcctgaatgaaacactgcaggaaggt
ggcacgcgagaagatgggctccgcatagtggagaagatgcagggccggagatatcagggt
gtgacgggagtggttgtcatggacaagaacaatgatcgggagacagactttgtcttgtgg
gccatgggtgacctcgattccggggatttccagccagctgctcactattctggggctgag
aagcagatctggtggaccgggcagcctattccatgggtgaagggggcacccccttccgac
aaccctccctgtgccttcgacttggacgacccctcctgtgataaaacccctttctccact
ctggccatcgtggctctgggcactggacttaccttcatcatgtttggggtctccagcttc
ctcattttccggaagctgatgctggagaaggagttggccagcatgctgtggcggatccgc
tgggaggagctgcagtttggcaatgccgagcgctaccataagagtgctgggagccggatc
accctctccctgcggggatccagttacggctcacttatgacagctcatgggaaataccag
atctttgccaacaccggtcacttcaagggaaacgtggtggccatcaaacatgtaaataag
aagcggattgagctgaccagacaggttctatttgagctcaagcatatgcgggatgtccag
ttcaaccatctgacccgcttcatcggggcctgcatcgacccgcccaacatctgcattgtt
accgagtattgtccccgaggaagcttgcaggacatcctggaaaatgacagcatcaatttg
gactggatgttccgctactcccttatcaatgacctcgtcaagggcatggcttttctccac
aacagcatcattggccaccacggcagccttaaatcctccaactgtgtggtggacagccgc
ttcgtgctaaagatcaccgactacgggttggccagcttccgctcagcaggggagcctgag
gacagccatgctctctatgccaaaaagctgtggactgccccagagcttctgtgcccagga
cgcttgccgaccatgggcatgcagaagggagacgtatacagctttgggatcatccttcag
gagattgctctacgcaacggccccttctacgtggaaggcatggacctgagtcccaaggag
attgtgcagaaagtgcgacatggccagcgtccatacttccggcccagcatcgatcggggg
caactgagcgaggagctggctatgctgatggaacgctgctgggcccaggaccctgctgaa
cggcctgactttagccagatcaagggcttcatccgccgcttcaacaaggaggggggcacc
agcatcctggataacctgttgttacgcatggagcagtacgccaataacctagagaagttg
gtagaggaaaggacgcaggcctacttggaggagaagcgcaaagctgaagccctgctctac
cagattctgccccactctgtggctgagcagctgaagcggggggagacagtgcgggctgag
gcttttgatagcgtcaccatctacttcagtgacatcgtgggcttcactgccctgtctgcg
gagagtacccccatgcaggtggtgacactgttgaatgacctgtacacctgcttcgatgcc
atcattgacaactttgatgtgtacaaggtggagacaatcggcgatgcctacatggtggtg
tcagggttgcctggacgcaatggcaaacggcacgcacctgagatcgctcgcatggccctg
gccctgctggaagctgtggcttcattccggatccgacaccggcccaatgaccagctgcgg
ctgcgcattggtgtccacacgggacctgtgtgtgctggggttgtcggcctgaagatgcca
cggtactgtctgtttggggacacagtgaacactgcctcacgcatggagtccaacgggcag
gactgccactttgccgacgtctttgattcctgcctcatttacaaacacctaagagtctgt
cctcatccagaagctgctccatcccctgatcatcttggttactcttctctgtcccttcgc
cagctctcttatgtccttcctaagatgcggagaccagactgcacacagagttccaggtcc
tcaccgtccttactgccaccatcctgccctgaagatccatgtctcctccaccaccaaaga
tgccttggatga

DBGET integrated database retrieval system