KEGG   Ornithorhynchus anatinus (platypus): 100088125Help
Entry
100088125         CDS       T01045                                 

Gene name
ATP1A3
Definition
(RefSeq) LOW QUALITY PROTEIN: sodium/potassium-transporting ATPase subunit alpha-3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04022  cGMP-PKG signaling pathway
oaa04024  cAMP signaling pathway
oaa04260  Cardiac muscle contraction
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04911  Insulin secretion
oaa04918  Thyroid hormone synthesis
oaa04919  Thyroid hormone signaling pathway
oaa04925  Aldosterone synthesis and secretion
oaa04960  Aldosterone-regulated sodium reabsorption
oaa04961  Endocrine and other factor-regulated calcium reabsorption
oaa04964  Proximal tubule bicarbonate reclamation
oaa04970  Salivary secretion
oaa04971  Gastric acid secretion
oaa04972  Pancreatic secretion
oaa04973  Carbohydrate digestion and absorption
oaa04974  Protein digestion and absorption
oaa04976  Bile secretion
oaa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100088125 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    100088125 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100088125 (ATP1A3)
   04918 Thyroid hormone synthesis
    100088125 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    100088125 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    100088125 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100088125 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    100088125 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    100088125 (ATP1A3)
   04971 Gastric acid secretion
    100088125 (ATP1A3)
   04972 Pancreatic secretion
    100088125 (ATP1A3)
   04976 Bile secretion
    100088125 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    100088125 (ATP1A3)
   04974 Protein digestion and absorption
    100088125 (ATP1A3)
   04978 Mineral absorption
    100088125 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100088125 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100088125 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    100088125 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oaa04147]
    100088125 (ATP1A3)
Enzymes [BR:oaa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100088125 (ATP1A3)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100088125 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   100088125 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   100088125 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   100088125 (ATP1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 100088125
NCBI-ProteinID: XP_028922449
Position
5
AA seq 1027 aa AA seqDB search
MGSGRSDSYRVATSQDKKDDKDSPKKSKANKERKDLDDLKKEVAMTEHKMSVEEVCRKYN
TDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYG
IQAGTEDDPAGDNLYLGIVLAAVVIITGCFSYYXEAKSSKIMESFKNMVPQQALVIREGE
KMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNP
LETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLIT
GVAVFLGVSFFVLSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNC
LVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSH
TWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKK
VAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQALDEELKE
AFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPR
AAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVN
PRDAKACVIHGTDLKDFSSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTG
DGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSI
AYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQP
RNPRTDKLVNERLISMAYGQIGMIQALGGFFAYFVILAENGFLPSNLVGIRLNWDDRMVN
DLEDSYGQQWTYEQRKSVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIF
GLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGW
VEKETYY
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggggtccggccgctctgacagctatcgtgtcgccacctcgcaggacaaaaaggatgac
aaggactcccccaagaagagcaaggccaacaaggagaggaaggacctggacgacctgaag
aaggaagtggctatgacagagcacaagatgtcggtggaagaagtctgcaggaaatataac
accgactgtgtccagggtctgacgcacagcaaagcccaggagatcctggcccgggacggg
cccaacgcgctgactccgcctcccaccaccccggagtgggtcaagttctgtcgccagctc
tttgggggcttctccatcctgctgtggatcggggcgatcctctgcttcctggcctacggc
atccaggccgggacagaagatgatcctgccggggacaacctgtacctgggtattgtcctg
gctgccgtcgtcattattaccggctgcttctcctactacnaagaggcaaagagctcaaag
atcatggaatccttcaagaacatggtgccccagcaagccctggtgatccgcgagggtgag
aagatgcaggtgaacgctgaggaggtggtggtgggcgacctcgtggagatcaagggggga
gatcgagtccccgccgacctgcgcatcatctccgctcacggctgcaaggtggacaactcc
tccctgacgggagagtcggaaccgcagacccgctccccggactgcactcacgacaatccc
ctggagacacgcaacatcaccttcttctccacgaactgcgtggagggcacggcccggggc
gtggtggtggccaccggagaccggacggtgatggggaggatcgccaccctggcgtcgggg
ctggaagtggggaagacgcccatcgccatagagatcgagcacttcatccagctcatcact
ggggtggccgtcttcctgggcgtgtccttcttcgtgctctccctcatcctgggctacacc
tggctggaggccgtcatcttcctcatcggcatcatcgtggccaacgtgcccgaggggctg
ctggccaccgtcaccgtgtgcctgaccctgacggccaagcgcatggcccgcaagaactgc
ctggtgaagaacctggaggcggtggagacgctgggctccacgtccaccatctgctccgac
aagaccggcaccctcacccagaaccgcatgaccgttgcccacatgtggttcgacaaccag
atccacgaggccgacactaccgaggaccagtccggcacctcttttgacaagagttcccac
acctgggtggccctgtctcatatcgctgggctttgcaaccgagccgtcttcaagggaggc
caagataacatccccgtgctcaagcgagacgtggcgggcgacgcctccgagtcggcgctc
ctcaagtgcatcgagctgtcgtccggctccgtgaagctgatgagggagagaaacaagaag
gtggcggagatccccttcaactccacgaacaagtaccagctctccattcatgaaacggag
gaccccaacgacaaccgctacctgctggtgatgaagggggcacccgaacgcatcctggac
cgctgctccaccatcctgctgcagggcaaggaacaggcgctggacgaggagctcaaggaa
gctttccagaatgcctacctggagctgggcggcctgggagagagggtgctgggtttctgc
cactattacctgcccgaggaacagttccccaagggcttcgccttcgactgcgacgatgtc
aacttcaccaccgacaacctgtgcttcgttggactcatgtccatgatcgacccgccccgt
gccgccgtgcccgacgccgtggggaagtgccgcagcgcgggcatcaaggtgatcatggtg
actggagaccaccccatcacggccaaggccatcgctaagggtgtgggcatcatctcggaa
ggcaacgagaccgtggaggacatcgccgcccgcctcaacatccccgtcagccaggtcaac
cccagggacgccaaagcctgtgtgatccacggaacggacctgaaggatttctcatcggag
cagatagacgagatcctgcagaaccacactgagattgtcttcgcccgaacctccccccaa
cagaagctcatcatcgtggagggttgtcagagacagggagccatcgtggccgtcaccggg
gacggggtcaacgactcccccgcgctgaagaaagccgacatcggcgtggccatgggcatc
gcaggctccgacgtgtccaagcaggcggccgacatgatccttctcgatgacaacttcgcc
tccatcgtcaccggcgtcgaggagggccgcctgatcttcgacaacctgaagaaatccatc
gcctacaccttaaccagcaacatcccggagatcacccccttcctgctgttcatcatggcc
aacatccccctgccgctgggcaccatcaccatcctctgcatcgacctgggcactgacatg
gtgcccgccatctccctggcatacgaggcggccgagagcgacatcatgaagaggcagccc
aggaaccctcggaccgacaaattggtgaacgagagactcatcagcatggcctacgggcag
atcggaatgatccaggcgctggggggcttcttcgcctactttgtgatcctggcggagaac
ggcttcctgccctccaacctggtgggcattcgcctcaactgggatgaccgcatggtgaac
gacctggaggacagttacgggcagcagtggacgtatgagcagaggaagtcggtggaattc
acctgccacacggccttcttcgtcagcatcgtcgtggtgcagtgggcagatctcataatc
tgcaaaacccgcaggaactccgtcttccagcagggcatgaagaacaagatcctgatcttc
ggactgtttgaggagacggcactggcagccttcctgtcttactgcccaggcatggacgtg
gccctgcgcatgtacccgctcaagcccagctggtggttctgtgcctttccctacagcttc
ctcatctttgtctatgacgagatccgtaaactcatcctacgcagaaatcctgggggttgg
gtggaaaaggaaacatactactga

DBGET integrated database retrieval system