KEGG   Ornithorhynchus anatinus (platypus): 100088436
Entry
100088436         CDS       T01045                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oaa01009]
    100088436 (AKAP5)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100088436 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 100088436
NCBI-ProteinID: XP_007658765
UniProt: F7B741
Position
1
AA seq 433 aa
METALPEIQVESKDHSQIHSSNELKTEANPQNEKPVEKSSFLCFKRKKKVVKASKFSKDD
SEPDSAAQKFQSQGSNMDHTKADVSDQSPIPQGAWAAIKHLVPHRKRSSSSSKKQRCSEA
TEQLGKKSDDTHVTKKKTRSKYKFPCIKFSRGKKKRGVSEMTEESDCVVKVKEVADSSDR
KTQTHQDDLTVKGELTTEFSGSASREDGDFISPNVSDIIISAQQDVISEEHQIDADQKNQ
VVQAETTTIENDSGDLEKSHAVQLQQESVTETLKESDQLPYTTDPTSSVVSEKFPLNSPE
VPTKIMEETKTVLEKGPSWEDGDRDLSLSEKSETKASSSESDFTETAVSVKPLKLEEYKK
MEPIAIIITDTEICEYDVTKSRNVPKQLLISEQYETLLIETASSLVKKAIQLSVEQLVNE
MASDNNKISNFLQ
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggaaacagcacttcccgaaatacaagtggaaagcaaggatcattcacaaattcatagt
tcaaatgagcttaagacagaagccaatcctcagaatgagaagccggttgaaaagtcatcg
tttctttgttttaaaagaaaaaagaaagtagttaaagcgtcgaagttctcaaaagacgat
tctgagccagactctgcggctcagaagtttcaaagtcagggcagcaacatggatcacaca
aaagcagatgtttccgatcagtctccgataccacaaggagcttgggctgctatcaaacat
ctggttccccataggaaaaggtcaagttcttcttcaaagaagcaaaggtgctctgaggct
actgagcagctggggaaaaagagtgatgatactcatgtcactaagaagaaaactcgttca
aaatataaatttccctgcatcaagttttcaagaggcaagaaaaaacggggcgtgagtgaa
atgactgaagaatcggactgcgtggtaaaagtaaaagaagtggcagacagttcagatagg
aaaactcaaactcaccaagatgatttgacagtgaaaggggaacttaccacagaattcagc
ggaagcgcctctcgggaagatggtgatttcatcagcccaaacgttagcgatatcatcatt
tctgctcagcaggacgtgatttcagaggaacaccaaatagacgctgatcaaaaaaatcaa
gttgttcaggcagaaacaaccactattgaaaacgattctggagacctagagaaaagccac
gctgttcaacttcagcaagaaagtgtcactgaaactctaaaagaatcagaccaactgcct
tacacgacagatcccactagctctgtagtttctgagaaattccccctaaattcacctgaa
gtcccaacaaaaatcatggaagagacgaaaactgtcctagaaaagggccccagttgggaa
gacggtgacagggatttaagtctctcagaaaaaagtgagaccaaagcgagctccagtgaa
tctgattttacagagactgcggtaagtgtgaagccactaaaactagaagaatacaaaaag
atggagccaatagctataattataacagacactgaaatctgcgaatatgatgtgaccaaa
tccagaaatgtccccaaacagctcttgatttcagaacaatatgaaacactcttaatagaa
actgcttcctcacttgtcaaaaaagccattcagttgtcagtcgaacagctggttaatgaa
atggcttcggacaataataaaataagtaattttctacagtga

DBGET integrated database retrieval system