KEGG   Ornithorhynchus anatinus (platypus): 100089687Help
Entry
100089687         CDS       T01045                                 

Gene name
SLC4A1
Definition
(RefSeq) band 3 anion transport protein isoform X1
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    100089687 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oaa02000]
    100089687 (SLC4A1)
   04147 Exosome [BR:oaa04147]
    100089687 (SLC4A1)
   04090 CD molecules [BR:oaa04090]
    100089687 (SLC4A1)
Transporters [BR:oaa02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100089687 (SLC4A1)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100089687 (SLC4A1)
CD molecules [BR:oaa04090]
 Proteins
  100089687 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto MFS_MOT1
Motif
Other DBs
NCBI-GeneID: 100089687
NCBI-ProteinID: XP_028930327
Position
11
AA seq 934 aa AA seqDB search
MEEQQEDYESEMEKTMETEDYQESEPPTTQEHPEEQEDFPPEQPSAEFPSTTDKGTHEAG
PLPPLPPLSSDPVPQAYVELQELVTDGRNREPLWMEAAHWVRLEENRGAEGGWGRPHLSF
LRFWSLLHLQRAFAKGTMLLDLDEQYMAGIAEKLCDQLIYEDQLKPQDRDALRRALLLKH
SPVGELETLGGVNPTVLQASGDTAEPLLLPESPSLEARLFWEPGEGSGEPSHVLEKIPPD
AEATLVLVGQAAFLQAPVLAFVRLKGPVKLEAIELPVPVRFLIVLLGPEAAHTDYGQMGR
AAATLMAERVFRVAAYMAQSRKELVEALEGFLDCSLVLPPTISSDDELLQSLVPLQTELL
RRHYQTVPTKGDPDFLKRIGPSRGPREPGGADDPLQRTGQLFGGLARDARRRYPRYLSDI
TDALSPQVLAAVIFIYFAALSPTITFGGLLGDKTRNQIGVSELLISTAVQGILFALLGAQ
PLLVIGFSGPLLVFEEAFYSFCEDNGMEYIVGRVWIGVWLVLLVVLVVAFEGSFLVRYIS
RYTQEIFSFLISLIFIYETFAKLIKIFQDHPLKRSYSSNDTWTHQPTVAQPNTALLSLVL
MAGTFLIAILLRKFKNSSYFPGKLRRIIGDFGVPISIFLMVLVDTFIQDTYTQKLKVPKG
LTVSNTTARGWFIHPLGLRRVFPYWMMFASVLPALLVFILIFLESQITTLIVSKPERKLV
KGSGFHLDLLLIVGMGGLGALFGMPWLSATTVRTVTHANALTVMASTTSTGDKSRVQEVK
EQRISGLLVSLLIGLSILMEPVLKQIPLAVLFGIFLYMGVTSLSGIQLFDRILLLLKPSK
HHPDVPYVKRVKTWRMHVFTGTQVICLILLWVVKSTPASLALPFILILTVPLRRFLLPFI
FRELELQCLDADDAEVVLDEEDGRDEYYEVQMPV
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacagcaggaggactacgagtccgagatggaaaagacaatggagaccgaggat
taccaggaatccgagcctcccacaacccaggaacacccagaagagcaggaggatttcccc
ccagaacagccgtctgcagaattcccttccaccacagacaaaggcacccacgaggctggg
cctctgccccccctgccccctctgtcctccgaccccgtgccccaggcctacgtggagctt
caggagctggtgacggacggccggaaccgggagccgctctggatggaggcggctcactgg
gtgcggctcgaggagaaccggggggctgaggggggctgggggaggccccacctctccttc
ctccgcttctggagcctcctgcacctccagcgggccttcgctaagggcacgatgctcctg
gacctggatgagcagtacatggccggcatcgccgaaaagctgtgcgaccagctcatctac
gaagaccagctcaagcctcaggacagggatgctctgcgccgggctctgctgctcaaacat
agtccagtgggggagctggagaccctcgggggggtgaaccccaccgtcctgcaggcctcg
ggggacaccgcagagccgctactgctgcctgaatcaccctccctggaagctcggctcttc
tgggaaccgggcgaaggcagcggggagccttcccatgtgctagagaagattcctcctgat
gccgaggccaccctggtgcttgtggggcaggctgctttcctgcaggctccggtcctggcc
ttcgtccggttgaaggggccggtcaagctggaggccatagagctgccggtgccggtccgc
ttcctgatcgtgctgctggggcccgaggccgcccacaccgactacggccagatgggccgg
gccgctgccacgctcatggctgagagggtgttccgcgtggcggcgtacatggctcagagc
cgcaaagagctggtggaggctctggaggggtttctggactgcagccttgtcctgcctccc
accatctcgtctgacgatgaactgctccaaagcctggtgcccctgcagaccgagctgctg
cgtcgccattaccagactgtgcccaccaaaggagaccctgacttcctcaagaggataggt
ccgtccaggggtcccagagagccgggcggagcggacgaccccttgcagaggacgggccag
ctgttcgggggtctggcccgcgacgctcggcgacggtacccccgctatctgagcgacatc
accgacgcgctcagcccccaggtcctggccgccgtcatcttcatctacttcgccgccctc
tctcccaccatcaccttcgggggcctcttgggagacaagacgcggaaccagatcggggtg
tcggagctgctcatctccacggcggtgcagggcatcctgtttgccctgctgggggcccag
ccccttctcgtgattggcttctcggggcccctgctggtcttcgaagaggccttttactcg
ttctgcgaggacaacgggatggagtacatagtgggccgcgtgtggatcggcgtctggctg
gttctgctggtggtgctggtggtggccttcgagggcagcttcctggtgcgctacatttcc
cgctacacccaggagatcttctccttcctcatctccctcatcttcatctacgagaccttc
gccaaactcatcaagatcttccaggaccatccgctgaagcgatcctacagctccaacgac
acctggacgcaccaacccaccgtggcccagcccaacacagccctgttgtccctggtgctc
atggcggggaccttcctcattgccatcctcctgcgcaagttcaagaacagctcctacttc
ccgggcaagctgcgccggatcattggtgactttggggtccccatctccatcttccttatg
gttctggtggacaccttcatccaagacacttacactcagaaactgaaggtgcccaaggga
ctgacggtgtccaacaccacggcccgaggctggttcatccacccgctgggcctgcgccga
gtcttcccctactggatgatgtttgcttccgtcctgcccgccctgctggtcttcatcctc
atcttcctcgagtcccagatcaccacgctgatcgtcagcaagccggagaggaagctggtg
aaagggtcgggcttccacctggacctgctgctgatcgtgggcatgggcgggctgggtgcg
ctcttcgggatgccctggctcagcgccaccaccgtgcgcacggtcacccacgccaacgcc
ctcaccgtcatggccagcacgacctccaccggggacaagagccgggttcaggaggtcaaa
gagcaacgtatcagcgggctcctggtctccttgctcataggcctctccatcctcatggag
cccgtcctgaagcagatcccgctggccgtgctctttgggatcttcctgtacatgggcgtc
acctcgctcagtggcatccagctcttcgatcgcatcctgctgttgctgaaaccctccaag
caccaccctgacgtgccctatgtgaagcgggtgaagacctggcgcatgcacgtgttcacg
ggcacccaggtgatatgcctgatcctgctctgggtggtcaagtccacgcccgcctccctg
gcactgcccttcatcctcatcctcacggtgcccctgcgccgtttcctgctgcccttcatc
tttcgcgaattagagctccaatgtctggacgcggacgacgcggaggtggtgttggacgag
gaagacgggagggacgagtactacgaggtgcagatgcccgtgtga

DBGET integrated database retrieval system