KEGG   Ornithorhynchus anatinus (platypus): 100089910
Entry
100089910         CDS       T01045                                 
Symbol
DYNLL2
Name
(RefSeq) dynein light chain 2, cytoplasmic
  KO
K10418  dynein light chain LC8-type
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04962  Vasopressin-regulated water reabsorption
oaa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100089910 (DYNLL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100089910 (DYNLL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:oaa03037]
    100089910 (DYNLL2)
   04812 Cytoskeleton proteins [BR:oaa04812]
    100089910 (DYNLL2)
Cilium and associated proteins [BR:oaa03037]
 Motile cilia and associated proteins
  Dynein arm
   100089910 (DYNLL2)
Cytoskeleton proteins [BR:oaa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100089910 (DYNLL2)
SSDB
Motif
Pfam: Dynein_light DUF6702 Nop Ectatomin
Other DBs
NCBI-GeneID: 100089910
NCBI-ProteinID: XP_001519193
Ensembl: ENSOANG00000042822
UniProt: A0A6I8PHH7
Position
17:10983363..11028792
AA seq 89 aa
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtctgaccggaaggctgtcatcaagaatgcggacatgtctgaggacatgcagcaggac
gcagtggactgcgcgacgcaggccatggagaagtacaacatagagaaagacatcgctgcc
tacatcaagaaggaattcgacaagaaatacaaccccacctggcactgcatcgtggggcgg
aattttggtagctacgtcacgcatgagaccaagcacttcatctatttttacttgggtcaa
gtggccatccttctcttcaagtccggttag

DBGET integrated database retrieval system