KEGG   Ornithorhynchus anatinus (platypus): 100092288Help
Entry
100092288         CDS       T01045                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04136  Autophagy - other
oaa04140  Autophagy - animal
oaa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100092288 (ATG16L1)
   04136 Autophagy - other
    100092288 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100092288 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oaa04131]
    100092288 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:oaa03029]
    100092288 (ATG16L1)
Membrane trafficking [BR:oaa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100092288 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    100092288 (ATG16L1)
Mitochondrial biogenesis [BR:oaa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100092288 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A HTH_6 Lipoprotein_6 SGL Fez1
Motif
Other DBs
NCBI-GeneID: 100092288
NCBI-ProteinID: XP_001520939
UniProt: F7A1C6
Position
1
AA seq 623 aa AA seqDB search
MAAGLRAPGLPGWRRHISEELRRRDRLQRQAFEEIILQYNKLLEKSDLQSVLAGKLQAEK
YDMQSKHEISQGHDGMWNNSQLQEMAQMRIKHQEELTELHKKRGELAQSVIDLNNQMQQK
DKEMQENEAKIAEYLRKIAELETECQELRNKLQDHERANQTLKDEYDALQITFTALEEKL
RKTTEDNQELVTRWMAEKAQEANRLNAENEKDSRRRQAKLQKELAEAAKEPLPVEQDDDI
EVLVDEVTDPAEETSPARASGRTTTKRLSQPAGGLLESLTNIFGLSESPLLGQPSSDAAR
RRSVSSSPVPQDTMGARSGSRKEVRVPTKAAYYFNAHDGEVNAVQFDPSSRLLATGGMDR
RVKLWEVFGDRCELKGSFAGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYWLRHTL
TGHSGKVLSAKFLLGKSLIVSGSHDRTLKLWNLQSRICTKTVFAGSSCNDIVCTEQCVMS
GHFDKKIRFWDIRAESIIREMELLGKITALDLNPERTELLSCSRDNLLNIIDLRVNAIKQ
TFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWNVLTGKVEKVLSKFHSSSINAVA
WSPSGVHVVSVDKSNKAVVWSDY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcctcagggcgcccggcctccccggctggaggcgccacatctccgaagag
ctgcggcggagggaccggctgcagaggcaggccttcgaggagatcatcctgcagtacaac
aagctgttggagaagtcagatcttcagtcagtgttggccggcaagctacaagctgaaaag
tatgacatgcaaagcaagcatgagatcagccaggggcatgatggaatgtggaacaatagc
caactgcaagaaatggcccagatgaggataaaacatcaagaagaactaactgaactgcat
aagaaacgtggggagttggcccagtcggtaattgacctgaacaaccaaatgcaacagaag
gacaaagagatgcaagaaaacgaagccaaaattgcagaatatctgcggaagatcgccgaa
ttagagacagaatgccaggagcttcgcaacaagctgcaggaccatgaaagggcaaaccag
accctgaaggacgagtacgacgccctgcagatcaccttcacggctttggaagagaagctg
aggaaaactactgaagacaaccaagagctggtcacccgctggatggcagagaaggcccag
gaagccaatcgcctaaatgcagaaaacgaaaaggactcaaggagacggcaagccaaactt
cagaaagagctagcagaagctgcaaaggaaccgcttcctgtcgaacaggatgatgatatt
gaagtgctcgtggatgaagttacggacccggctgaggagacctctccggcacgagcctcc
ggtcgaacgaccactaagcgactctcccagcctgctggaggccttctggaatctctcact
aatatctttggtctgtccgaatctccacttttgggacaaccctcttctgatgctgccagg
aggcgttctgtgtcttcctctcccgtcccccaagataccatgggagcccgttctggttcc
aggaaagaagtgagggtgcccacgaaagcagcttactattttaatgcccacgacggagag
gtgaacgccgtgcagttcgatcccagttccaggttattggcaacaggaggcatggaccga
agggtcaaactctgggaagtgtttggagataggtgcgagttaaagggctcctttgctggc
agtaacgcgggaattacaagcattgaatttgatagtgccggctcttacctcttagcagct
tcaaatgattttgccagcaggatatggactgtggatgattactggttgcggcacacgctg
acgggacacagtgggaaagtgctgtcggctaagttcctgttgggtaaatcacttattgtt
tcaggaagtcatgaccggaccctcaaactctggaatctgcagagcagaatctgtacaaaa
acagtgttcgcaggatccagttgcaacgatattgtctgcaccgagcagtgtgtgatgagc
ggacattttgacaagaaaatccgtttctgggatatccgagctgaaagtataatccgagaa
atggagcttttgggaaagatcaccgccctggatctgaacccagagagaacagagctcctg
agctgttcccgggataacctgctaaatattattgaccttcgagtcaatgctatcaaacag
accttcagtgctccaggattcaagtgtggatctgattggactagagttgttttcagtccc
gatggcagttacgtggcagccggctcagctgagggatctctctacgtctggaatgtgctc
actggaaaagttgaaaaagtcctttcaaagtttcacagctcttccatcaacgcagtggct
tggtcaccctctggtgttcatgtagtcagtgtggacaaaagcaacaaagcagtcgtgtgg
tctgactactga

DBGET integrated database retrieval system